KEGG   Delftia acidovorans: Daci_3837
Entry
Daci_3837         CDS       T00620                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
dac  Delftia acidovorans
Pathway
dac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_3837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_3837
Secretion system [BR:dac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Daci_3837
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABX36468
UniProt: A9BLI3
Position
complement(4228393..4228875)
AA seq 160 aa
MSVDMFMKVEGASGESQDSNHKGWTDIDSFTWGATQPNTMSSGGGAGAGKVSFHDLNVIA
KVDKCYPAVLKHCATGKHLGQVDISLCKAGGTQIEFTKITLTDVMVTNVTVSGANSSDTV
TVNYSFQAAKVKTQYWEQTNQGGKGAESQMGFNIKENREA
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtccgttgatatgttcatgaaggtcgagggcgccagtggcgagtcccaggattccaac
cacaagggctggaccgacatcgactccttcacctggggtgctacccagcccaacaccatg
tccagcggcggtggtgccggcgccggcaaggtgagcttccatgacctgaacgtcatcgcc
aaggtggacaagtgctaccccgccgtgctcaagcactgcgccacgggcaagcacctgggc
caggtcgacatctcgctgtgcaaggccggcggcacgcagatcgagttcaccaagatcacc
ctgaccgacgtcatggtgacgaacgtgaccgtcagcggcgccaactcctctgacaccgtg
accgtgaactactcgttccaggctgccaaggtcaagacccagtactgggagcagaccaac
cagggcggcaagggcgccgagagccagatgggcttcaacatcaaggaaaaccgcgaagcc
tga

DBGET integrated database retrieval system