KEGG   Delftia acidovorans: Daci_3850
Entry
Daci_3850         CDS       T00620                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_3850
Secretion system [BR:dac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Daci_3850
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABX36481
UniProt: A9BLJ6
Position
4245030..4245572
AA seq 180 aa
MSLTKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVLADLSGKPVDPLPEI
ADRKFLEIDIDNFDARMKSIKPRVAFQVDNTLTGEGKLNIDLSFESMEDFSPAAIARRVG
ALNSLLEARTQLHNLLSYMDGKQGAEELIGKVLKDPALLKSLAAAPNITAPQASGPASEA
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtcgctcaccaaaaccggcaagagtggtcagaaattcatcgcgcgcaaccgtgcgccg
cgcgtgcagatcgagtacgacgtcgagatctacggctcggaaaagaaggtgcagatcccc
ttcgtgatgggtgtgctggccgatctgtcgggcaagcccgtcgatccgctgcccgaaatc
gccgaccgcaagttcctggaaatcgacatcgacaacttcgatgcgcgcatgaagtccatc
aagccccgcgtcgccttccaggtggacaacacgctgacgggcgagggcaagctcaacatc
gacctgagcttcgagagcatggaggacttctcccccgccgccatcgcgcggcgcgtgggc
gcgctcaactcgctgctggaggcacgcacccagctgcacaacctgctgtcctacatggac
ggcaagcagggcgccgaggagctgatcggcaaggtgctcaaggaccctgcgctgctcaag
tcgctggccgccgcgcccaacatcactgccccgcaggcctcgggccctgcatccgaggct
tga

DBGET integrated database retrieval system