KEGG   Delftia acidovorans: Daci_4164
Entry
Daci_4164         CDS       T00620                                 

Definition
(GenBank) putative secreted protein
Organism
dac  Delftia acidovorans
SSDB
Other DBs
NCBI-ProteinID: ABX36795
UniProt: A9C2Z1
Position
4557694..4558272
AA seq 192 aa
MPAIPVSRRLVGAGLLAAALASGCATTTAPLVPDAIEGVSSAPEPEAPEFIPVVRYGRYT
LVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYQLCETPSAVTELYALPL
PAAHRHLGPMTLRDALLTLAGPAWELHADERARQICFEQPGGSATAEHAHEPPVAEAVQT
FPLMPSVSGGQP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcccgcaatccctgtatcccggcgtctggtcggcgctggtctcctggccgcagcgctg
gccagcggctgcgcgaccaccaccgcgccgctggtgccagacgccatagaaggcgtctcc
tccgctcccgaacccgaggcacccgagttcattcccgtcgtgcgctatggccgctacacg
ctggtcgagctggcacccacggcggcgcagcgtgacttgctgttgcagaccatcgacgtg
tccatgcccgaggatgcccgcgccacggtgggcgatgggctgcggcatgtgctcaaacgc
agtggctaccagctttgcgagacgcccagcgccgtgaccgagttgtatgcgctgccgctg
ccggcggcgcaccggcatcttggccccatgaccttgcgcgatgcgctgctcaccctggcc
ggcccggcctgggaactgcatgcggatgaacgggcacggcagatttgctttgagcagcct
ggaggcagtgcgaccgccgagcacgcacacgagccgcctgttgccgaggcggtgcagacg
tttccgctgatgccttcggtttcgggaggccagccatga

DBGET integrated database retrieval system