KEGG   Delftia acidovorans: Daci_4168Help
Entry
Daci_4168         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-ProteinID: ABX36799
UniProt: A9C2Z5
Position
4560246..4560794
Genome map
AA seq 182 aa AA seqDB search
MKTCHLTHLTLKGLLVLLAALPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPAG
PPIPMLPVPATPMDEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVVGDDEASHAWLLRQ
AGSLRERGAVGLVVNVETMQGLARLRALVPGVPLAPVAGDDLAERLGLRHYPVLITATGI
EQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatgccatttgacccatctcacactgaagggcctgctcgtgctgctggcggct
ctgccactggcctcgcgcgccggagagcccctgatcgtcgtcgaagaccgtggcggcacg
tcggcgctgccgtactacgaggctctgaaccttcagccgcgcgccaatgctccggccggg
ccgcccatcccgatgctcccggtgcccgccacgcccatggatgaggccgcgatgttgccg
gtgcgcagtgccaagctcacgcctggcaccgtcgcgcggcgcgtgatcgaggcaccgggc
ctgcggcctttcgtagtcgtcggcgacgacgaagcttcccacgcctggctgcttcgccag
gcgggctcgctgcgcgagcgcggcgcggtgggcctggtggttaacgtcgagaccatgcag
ggcctggcacggctgcgcgccctggtgcccggcgtgccccttgcgcctgtggccggtgac
gacctggccgagcgcctgggtctgcggcattacccggtgctgatcacagccaccggcatc
gagcaatga

DBGET integrated database retrieval system