KEGG   Delftia acidovorans: Daci_4169Help
Entry
Daci_4169         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Motif
Other DBs
NCBI-ProteinID: ABX36800
UniProt: A9C2Z6
Position
4560799..4562982
Genome map
AA seq 727 aa AA seqDB search
MSGKQPVEVLLRPAVEFYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFCIYGAIRYR
DARVILRYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
ELTPAYRLARRLEERLEFAPFPLSRLPALTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNADGEHEVVIVIDPKGDADLLKR
VYVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRVAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGSRVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHIVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPADLQQLAGHMRQSYSEATQWWEFTSSPVLQDAALPDDLLDETAIATPTTGTGDT
ASEEAAP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaaacagccggtcgaggttctgctgcgcccagcggtggagttctataccgtc
gcggcgtgtgcaggcgccgcgtttctgtccctggtggccccgtggtcgctcgcgctgagc
cccgccatgggcgtcggcagtgcgctggcgttctgcatctacggtgccatccgctaccgc
gatgcccgcgtcatcctgcgctaccgacgcaacattcgccgcttgccgcgctatgtgatg
accagcaaggacgtgccggtcagccagcagcgtctgttcgtgggacgcggatttctgtgg
gagcagaaacatacccatcggctgatgcagacatacagaccggaatttcgccgctacgtc
gagctgacgccggcctaccggctggcgcgcaggctggaggaacggctggagttcgcgcca
ttcccgctgtcccggctacctgcgctcacgggctgggatgtgcctttcaacccggtgcgc
ccgctgccgcctgtgggcggcctgccgcgcctgcacggcatcgaacccgatgaggtggac
gtcagcctaccgctgggtgagcgcgtcgggcattcgctggtgctgggcaccacgcgcgtg
ggcaagacgcggttggccgagttgttcgtgactcaggacatccggcgcaagaacgccgac
ggcgagcacgaggtcgtcatcgtcatcgaccccaagggcgacgccgatcttttgaagcga
gtgtacgtcgaggccaagcgcgcggggcgcgagggcgagttctatgtcttccacttgggc
tggcccgacatttccgcgcgctacaacgctgtgggccgctttgggcgcatcagcgaggtg
gccacccgtgttgcagggcagctctccggggaaggcaacagcgcggcatttcgcgagttt
gcgtggcgcttcgtcaacatcatcgcccgcgccctggtggaactggggcagcgcccggac
tacatgctgatccagcgccatgtgatcaacatcgacgcgctgttcatcgagtacgcccaa
cactacttcgccaagaccgagcccaaggcctgggaggtcatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgatcgggcgcgaaaagcgcgtggtggcgctg
gagcagtacctctcgcaggcgcgcaactacgacccggtgctcgacggcctgcgctcggca
gtgcgctacgacaagacctacttcgacaagatcgtcgcatcgctgctgccgctgctggag
aagctcaccagcggcaagatcgcccagcttctggccccgaactactccgacctggccgac
ccacgcccgatcttcgattggatgcaggtcatccgaaagcgcgccgtggtctatgtcggc
ctcgatgcgctgtccgacgccgaggtcgccgccgcagtcggcaattccatgttctccgac
ctggtttcggtcgccggccacatctacaagcacgggatcgacgacggcctgccgggcgca
tcggctggctcgcgcgtgccgatcaacgtccatgccgatgagttcaacgagttgatgggc
gacgagttcatcccgctgatcaacaagggcggcggcgctggcctgcaagtcaccgcgtac
acacagacgctctcggacatcgaagcacgcattggcaaccgcgcgaaggccggtcaggtg
atcggcaacttcaacaacctgttcatgctgcgcgtgcgcgagacggctaccgctgaattg
ctgacccggcaattgccgaaggtcgaggtctatacgaccaccatcgtcagcggcgcgacc
gacagctccgatattcgtggagcgacagactttacgtcaaacacccaagaccgcatcagc
atgtccagcgtgccgatgatcgagccatcgcacatcgtcggcctgcccaaaggccagtgc
ttcgcgctgctgcagggcggtcagctttggaaggtgcgtatgccgttgccggcgccagac
ccggatgaagtgatgccggcggacttgcagcaactggccgggcacatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagctccccggtcttgcaggacgcggccttg
ccggacgatctgctcgatgagacggccatcgccacacccaccaccggcacgggcgacacg
gccagcgaagaggccgcgccatga

DBGET integrated database retrieval system