KEGG   Delftia acidovorans: Daci_4176Help
Entry
Daci_4176         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein; putative signal peptide
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438 TPPK_C FAM117
Motif
Other DBs
NCBI-ProteinID: ABX36807
UniProt: A9C303
Position
4565938..4566876
Genome map
AA seq 312 aa AA seqDB search
MKPMKHPVLALLGLLAVAAAVVVSPAVQAVEILRWERMPLAVPLKVGQERIVFIDRNVRV
GVPAGVGERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELE
PVRIVEGNNSTARYGDQPDGADAPHARAQEQAGTRTARRETPIPVVLTRFAAQNLYAPLR
TVEALPGVMRVNLRRDLDLGTLMPTLPARAVALASWRLEDQWVTAVRLTNSSNDWISLDP
RVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDPAVHLPQPKA
AASDDREARHAQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccatgaagcatcctgtactcgcgctgctggggctgctggccgtggccgccgca
gtggtcgtgtcccccgctgtccaggcggtggagatcctgcgttgggagcgcatgccgctg
gcggtgccgttgaaggtcggccaggagcgcatcgtgttcatcgaccgaaacgtccgcgtg
ggcgttcccgcaggcgtcggtgagcgcttgcgcgtgcagagcgcgggcggcgcggtgtac
ctgcgcgccagcgagccgatcgagcccactcggctgcaattgcaggacgccgacaccggc
gcgctgatcctgctcgacattgcggcggagccgcccaaggacggcgaagccgagctggaa
ccggtgcgaatcgtcgagggcaacaactcaacagcgcgctatggcgatcagcctgacggt
gccgatgcgccccatgcacgcgctcaggagcaggcgggcacccggacggcgcggcgcgaa
acgccaatccccgtcgtgctgacacgttttgctgcgcagaacctctacgcaccgctgcgc
accgtggaagccttgccaggcgtcatgcgggtcaacctgcgccgcgacctcgacctcggc
acgctgatgccgaccttgccggcacgcgcggtcgcgctcgcctcgtggcgcctggaagac
cagtgggtcactgccgtgcgcctgaccaacagtagcaacgactggatcagcctcgacccg
cgcgtgctgcaaggggatttcctcaccgccaccttccagcacgaggcgcttggcccgcgc
ggaacccccgaggacaccaccgtcctgtacctggtgacgcgcgggcacggcctcgcgcaa
tcgctgctgccggcgatccatcgcttcgaccccgctgtgcatctcccgcagcccaaagca
gcagccagcgacgacagggaggcccgccatgcgcagtaa

DBGET integrated database retrieval system