KEGG   Delftia acidovorans: Daci_4603Help
Entry
Daci_4603         CDS       T00620                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dac  Delftia acidovorans
Pathway
dac00071  Fatty acid degradation
dac00072  Synthesis and degradation of ketone bodies
dac00280  Valine, leucine and isoleucine degradation
dac00310  Lysine degradation
dac00362  Benzoate degradation
dac00380  Tryptophan metabolism
dac00620  Pyruvate metabolism
dac00630  Glyoxylate and dicarboxylate metabolism
dac00640  Propanoate metabolism
dac00650  Butanoate metabolism
dac00900  Terpenoid backbone biosynthesis
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
dac01212  Fatty acid metabolism
dac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daci_4603
   00630 Glyoxylate and dicarboxylate metabolism
    Daci_4603
   00640 Propanoate metabolism
    Daci_4603
   00650 Butanoate metabolism
    Daci_4603
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Daci_4603
   00072 Synthesis and degradation of ketone bodies
    Daci_4603
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Daci_4603
   00310 Lysine degradation
    Daci_4603
   00380 Tryptophan metabolism
    Daci_4603
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Daci_4603
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daci_4603
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daci_4603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dac04147]
    Daci_4603
Enzymes [BR:dac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Daci_4603
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daci_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABX37232
UniProt: A9C3C1
Position
5061547..5062746
Genome map
AA seq 399 aa AA seqDB search
MNPQDAPVILAWARSPVAPVGGALRELAAHELGAPVLQALLARAGLPARAVDAVVLGNAL
GAGGNPARMLALAAGLPERCAAHSVDTQCCSGLDSVALAAGLLMSGQASIVVAGGAEAWS
RAPIRQTRPRHADELPVTYDRPAFAPDPARDPDLLQSAADHALAHGITRAVQEAHAIHSH
ALALAHRDRLAQEIVPMAGLDHDAYPRALNPARVARMPVVAEAAGAVDAHARQRHALSTP
AISPKADGAALVLLATPQACARLGLQPRARWIASASLGHAPETPLVAAALAAQQVLERAA
AALQRPCLTAPELQAVELHDAFAVQALAFAETLGLPLQQLNTGGGGLARGHPIGASGAVA
LVRMLSDLHRTPAAHRPALGLAAIAGAGGIGAACLVQAL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcaagacgcccccgtcatcctggcctgggcgcgcagccccgtcgcccccgtg
ggcggtgcgctgcgcgagcttgcggcgcacgaactgggcgcgcccgtgctccaggccctg
ctggcccgggccggcctgcctgcccgggccgtggatgccgtggtcttaggcaacgccctg
ggcgcaggcggcaacccggcccgcatgctggccctggcggcaggcttgcccgagcgctgc
gcggcccacagcgtggacacccaatgctgctcgggcctggacagcgtggccctggctgca
ggcctgctgatgtcgggccaggccagcattgtggtggccggtggtgccgaggcctggagc
cgtgcccccatccgccagacacgcccgcgccatgcagacgagttgcccgtcacctatgac
cgccccgccttcgctcccgaccccgcacgcgacccggacctgctgcaatcggccgccgac
cacgcgctggcccatggcatcacccgcgccgttcaggaggcccatgccatccacagccac
gcgctggcgctcgcgcaccgcgaccggctggcccaagagatcgtgcccatggcggggctg
gaccacgacgcctatccgcgcgccttgaacccggcccgcgttgcccgcatgcccgtggtg
gccgaagcggctggcgccgttgacgcccatgcacgccagcgccatgcactgagcacaccc
gccatctcgcccaaggccgatggtgccgccctggtgctgctggccacgccgcaggcttgc
gcacgcctgggcctgcagccacgcgcccgatggattgccagtgcctcgctgggccatgcg
cctgaaacaccactggtcgccgccgcactggcggcccagcaggtgctggagcgtgcagcc
gcagcgctgcagcggccttgcctgactgcgccagagctccaggctgtggagctgcacgat
gccttcgccgtgcaggccctggcctttgccgaaaccctgggcctgccgctgcagcagctc
aacaccggcggcggtggcctggcgcgcggccatcccataggcgcatcgggcgcggttgcg
ctggtgcgcatgctctcagacctgcaccgcacgccagcagcccacagaccggctctgggc
ctggccgccattgcaggggcgggcggcataggcgcggcctgcctggtgcaggcgctttga

DBGET integrated database retrieval system