KEGG   Delftia acidovorans: Daci_4901Help
Entry
Daci_4901         CDS       T00620                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
dac  Delftia acidovorans
Pathway
dac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daci_4901
DNA repair and recombination proteins [BR:dac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Daci_4901
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Daci_4901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 zf-RING_9 PHF5 Cas_APE2256 Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: ABX37530
UniProt: A9BMI5
Position
complement(5414710..5415300)
Genome map
AA seq 196 aa AA seqDB search
MSDVQSLDGLIEALRRLPGVGIKSAQRMAFHLLQRDQDGARQLARALTTAVESVTHCERC
HTFTEGRICSICQDEGRDAARLCVVEAPADMAAMERTGAYQGYYYVLMGRLSPLDGIGPR
DLNLSSLLERAGDGKVQEVILATSFTAEGEATAHAISEALKARGIHVTRLARGVPIGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtgcaatcgctcgatggcctgatcgaggccttgcgcaggctcccgggtgtg
ggcatcaagtcggcgcagcgcatggccttccacctgctgcagcgcgaccaggacggcgcg
cggcaactggcccgtgccctgaccacggccgtggagtcggtcacccactgcgagcgctgc
cataccttcaccgaaggccgcatctgctccatctgccaggatgaagggcgcgacgcggcc
cggctgtgcgtggtggaggcgcccgccgatatggcggccatggagcgcacgggtgcctac
cagggctattactacgtgctgatggggcggctgtcgccactcgacggcataggtccgcgc
gatctgaacctgtcatccctgctggagcgtgccggcgacggcaaggtgcaggaggtgatc
ctggccaccagcttcacggccgaaggcgaggccacggcccatgcgatcagcgaggccctg
aaggcgcgcggcatccatgtgacgcggctggcgcgcggcgtgcccataggcagcgaactc
gaatacgtggacctgggtacgatcgcccatgcgctggtggaccgccggtag

DBGET integrated database retrieval system