KEGG   Delftia acidovorans: Daci_5065Help
Entry
Daci_5065         CDS       T00620                                 

Definition
(GenBank) protein of unknown function DUF299
  KO
K09773  [pyruvate, water dikinase]-phosphate phosphotransferase / [pyruvate, water dikinase] kinase [EC:2.7.4.28 2.7.11.33]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_5065
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.28  [pyruvate, water dikinase]-phosphate phosphotransferase
     Daci_5065
   2.7.11  Protein-serine/threonine kinases
    2.7.11.33  [pyruvate, water dikinase] kinase
     Daci_5065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinase-PPPase
Motif
Other DBs
NCBI-ProteinID: ABX37694
UniProt: A9BMZ9
Position
5612999..5613820
Genome map
AA seq 273 aa AA seqDB search
MHTHTIFVISDGTGITAETFGTAIMAQFDTKSRLVRIPFVDTMDKVHQAVRQINHVAESE
SHKPIVFTTLVNQDMLDLIESQCKGKVFDMFGTFVRPLELELGQKSLHRVGRFADISESK
EYLERMEAINYTLAHDDGQTHQDLTGADVILVGVSRSGKTPTSLYLAMQFGLKVANYPLI
PEDFERKQLPPALVPSRKKLFGLTIDPQRLSSIRNERRPDSKYASLVNCRYEVAEAESMM
RRSGIPWLSSTTKSIEEIATTILQEVLPQHLGH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcacacccacaccatcttcgtcatctccgatggcactggcattacagccgagaccttc
ggcacggccatcatggcccagttcgacaccaagtcgcgcctggtccgcatccccttcgtg
gacaccatggacaaggtgcaccaggccgtgcgccagatcaaccatgtggccgagtcggaa
agccacaagcccatcgtcttcaccaccctggtcaaccaggacatgctcgacctgatcgag
tcccagtgcaagggcaaggtgttcgacatgttcggcaccttcgtgcggccgctggagctg
gagctgggccagaaatcgctgcaccgcgtgggccgcttcgccgacatcagcgagagcaag
gaatacctggagcgcatggaggccatcaactacacgctggcccatgacgacggccagacc
caccaggacctgacgggcgccgacgtgatcctggtcggcgtgtcgcgcagcggcaagacc
cccaccagcctgtacctggccatgcagttcggcctcaaggtggccaactacccgctgatc
cccgaggatttcgagcgcaagcagctgccgcccgccctggtgccctcgcgcaagaagctg
ttcggcctgaccatcgatccgcagcgcctgtccagcatccgcaacgaacgccggcccgac
tccaagtacgccagcctcgtcaattgccgctacgaggtggccgaggccgaatccatgatg
cgccgcagcggcataccgtggctgtcgagcacgaccaagtccatcgaggaaatcgccacc
accatcctgcaggaggtgctgccccagcacctggggcactag

DBGET integrated database retrieval system