KEGG   Delftia acidovorans: Daci_5179
Entry
Daci_5179         CDS       T00620                                 

Definition
(GenBank) NADH-quinone oxidoreductase, B subunit
  KO
K00331  NADH-quinone oxidoreductase subunit B [EC:7.1.1.2]
Organism
dac  Delftia acidovorans
Pathway
dac00190  Oxidative phosphorylation
dac01100  Metabolic pathways
Module
dac_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Daci_5179
Enzymes [BR:dac01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Daci_5179
SSDB
Motif
Pfam: Oxidored_q6
Other DBs
NCBI-ProteinID: ABX37808
UniProt: A9BNB3
Position
complement(5745365..5745844)
AA seq 159 aa
MIEGVMKEGFITTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIGRFGSEVFR
ASPRQSDLMIVAGTLCNKMAPAMRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCD
RIVPVDVYVPGCPPTAEALIYGIIQLQQKIRRTHTIARV
NT seq 480 nt   +upstreamnt  +downstreamnt
atgatcgaaggcgtgatgaaagaaggcttcatcaccacgagttacgactctgtggtgaat
tgggccaagacgggctcgctgtggcccatgacatttggtctggcctgctgcgcggtggag
atgatgcacgctgcggcggcgcgttacgacatcggtcgctttggctcggaagtcttccgt
gccagcccgcggcagtcggacctgatgattgtggccggcaccctgtgcaacaagatggcg
cccgccatgcgcaaggtctatgaccagatgtccgagccccgctgggtcatctccatgggc
tcgtgcgccaacggcggcggctactaccactacagctattccgtggtgcgcggctgtgac
cgcatcgtgccggtcgatgtctatgtgcctggctgcccccccacggcggaagccctgatc
tacggcatcatccagctgcagcagaagatccgccgcacccataccatcgctcgcgtctaa

DBGET integrated database retrieval system