KEGG   Delftia acidovorans: Daci_5182Help
Entry
Daci_5182         CDS       T00620                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dac  Delftia acidovorans
Pathway
dac00010  Glycolysis / Gluconeogenesis
dac00051  Fructose and mannose metabolism
dac00562  Inositol phosphate metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
dac01230  Biosynthesis of amino acids
Module
dac_M00002  Glycolysis, core module involving three-carbon compounds
dac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_5182
   00051 Fructose and mannose metabolism
    Daci_5182
   00562 Inositol phosphate metabolism
    Daci_5182
Enzymes [BR:dac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daci_5182
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daci_5182
  Exosomal proteins of bladder cancer cells
   Daci_5182
  Exosomal proteins of melanoma cells
   Daci_5182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3530 CutC
Motif
Other DBs
NCBI-ProteinID: ABX37811
UniProt: A9BNB6
Position
complement(5746954..5747700)
Genome map
AA seq 248 aa AA seqDB search
MKKKLIVGNWKMNGGLAANAVLLKALKEGLPEGGNAGVAVAVPAVYLAQAQAELEGSAIG
VAAQDVSQHESGAYTGELSAAMLRDFGVRYTLVGHSERRQYHGETDAVVALKAQAALAKG
VTPIVCVGETLAEREAGQTEEVVKRQLAAVIHQVGQCINELVVAYEPVWAIGTGRTATPE
QAQQVHAVLRAQLAAASQQADRIALLYGGSMNASNAAQLLAQADIDGGLVGGASLKAADF
LTIIAAAQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaactcatcgtcggcaactggaagatgaatggcggcctggctgccaatgcc
gttttgctcaaggccctcaaggagggtctgcccgagggaggcaatgcgggcgtggctgtg
gccgtgcctgccgtctatctggcccaggcccaggccgagcttgaaggctcggccatcggc
gtggccgcgcaggatgtgtcgcagcatgaatcgggtgcctatacgggcgagctgtcggcc
gcaatgcttcgggattttggcgtgcgctatacgctggtggggcactcggagcgtcgccaa
taccatggcgaaaccgatgccgtggtggcgctgaaggcgcaggctgcgctggccaagggc
gtcacgcccatcgtctgtgtgggtgaaacgctggcggagcgcgaggcggggcagaccgaa
gaagtggtcaagcgccaactggcggccgtgatccaccaggtgggtcagtgcatcaatgag
ctggtcgtggcctatgagcccgtctgggccatcggcaccggcaggaccgccacgccggag
caggcccagcaggtgcatgccgtgctgcgcgcccagctggcggctgccagccagcaggcc
gatcgcatcgccttgctgtacggcggcagcatgaatgcctccaatgcggcccagctgctg
gcccaggccgacattgatggtggcctggtgggcggagcttcgctcaaggcagccgatttc
ctgaccatcatcgctgcggcccagtaa

DBGET integrated database retrieval system