KEGG   Delftia acidovorans: Daci_5511Help
Entry
Daci_5511         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Big_7 CarboxypepD_reg SdrD_B SpaA Big_3_5 Big_6 DUF3438 NosD
Motif
Other DBs
NCBI-ProteinID: ABX38140
UniProt: A9BX64
Position
complement(6119167..6123525)
Genome map
AA seq 1452 aa AA seqDB search
MQRSPFFQHARSFLCAAGWSKPLAVLRHRSVAALAIALGMTTAIAADTAQLTIADGVIVK
FGQGAGISVRGGLHTGSSVVLTSSHDDSQLGPVQPQGPQTRAPQAGDWLGVLVAPEALPA
HLKLDGLSIHHAGSTDGLPSHMAGGAGLVLAGGGYSFDRLQLTGNAVGIRVVGSGSPRIT
RSRITGNGVGLLAEQSATPAIGESDISANAQFGIRNTSPASIVQAQGNWWGHASGPRDAV
ANPAGQGNAVSTGVDYGSYLTAEPVLACAIVPTQGYAARVRVVELRLDCPQAAQYRLQES
DPFDGVAWQNMVGHPTLASYTLSMGAGDKMIHVQFRTAQGGINQFSLAQPIAYAPEGPLV
QFAQPAAGAVLEQDTAIAINVTDPEGVQQVEILVDGQRLALLTQPPFQTTWALAAVRNGN
YTLQARATNGIGLSNTATRPVQVQKKAGQGPALTATFAGTALVPNAAISAAGELAVSAQS
PIGIASVKATINGLQIFERSGGSTSPFSHSQFIDFAQLPNGVHRFGITATDVDGVSAVLD
IPFTLSLSAPPAPVIAQPINNAQVSTPQLMVSGTAMAGSQVQLYLGGQAVGSPMAVPANG
SFSGSLTLPAEGTHRIEATASNARGTSPRSAVVAVTYTITAPTVNFTVPGQDVSVVGSTA
VGVAASAPDGIAKVDFFANGSLIGSATQAPYSVQWDTSGVANGALTLRAVASSKAGKTGE
ATRSVTVNNKPPEPEQPKTPYTGTVSSVSPAVSYGAQRVVIAGAAVSRASGQPMPNAALR
MVLDISGFKRRIGIATDDSGQYRYEFVPTANDNGTYIVSVIHPEETATTEQGRFTINRLS
FDLASYQLTAPRGFAASITVNARASAGTGATGVRWAVVPAQQPSGSLPPGISVEPGAPVN
VAAGASVPMVIRFTGSASAGETGTVVLTAYASETGDTPRGSFTIHYRLVQALPELFANPT
YIETGVQQEKTVTEGITIGNRGLVAAQDVKVQLVDKDGKAAPSWIFLSSASHIGAVDVGA
QVPIQVTASPGKDVADGIYNYRLQITASNQGTGTIPVSVAVTQSGQGGLSFHATDLFTET
LDAGGKPIPGVANVRIRLQNDAVLTYLRTLTTDAQGKAVLTDLPPGTYTYRASGPRHADR
SGRIFVRPGVTTSERVHLQYQTISIDFSVTETTIKDEYQITLEATFQTQVPAPVVLLEPL
SISLPELQVGEEFTGELTLTNYGLIQADKVVFTPPQSDEYYRYEFLADIPKTLAAKQRVV
IPYRITAVKLHPRSMGFRQARSAEMGAVQSIVVNARNAGSCAAYAMWATVELAWICANGE
EESRSLSATFNRLVGSACVSTGIGGIGGTGGHGVGGGSGGWGSSGGTGGGGTPIGLTQGC
TPWCLGGGCSAEGSSPGGAGGGGTGGTGFGGSPPLKGSSPWGGGAGGEGPGGKPGAPGDG
GQGPDGTPGCGE
NT seq 4359 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgctccccgtttttccaacacgcccgttcctttctgtgtgcggccggctggagc
aagccgctggctgtgctgcggcatcgttccgttgcggccctggccatagccctgggcatg
accacagccatcgccgccgacacggcccaactgaccattgccgatggcgtgatcgtcaaa
ttcggccagggcgccggcatcagcgtgcgtggtggcctgcacacaggatcttccgtggtg
ctgaccagcagccacgacgactcgcaactgggcccggtgcagccgcaggggccgcaaacc
cgggcgccgcaggccggcgactggctgggggtactggtggcgcctgaagcccttcccgcc
cacctgaagctggatggcctatccatccaccatgccggtagcaccgacggcttgccaagc
catatggcaggcggtgcgggtctggtgctcgcagggggtggctacagctttgaccggctg
caactcactggcaacgccgtcggcattcgcgtcgtgggcagcggcagcccccgcatcaca
cgctcgcgcatcacaggcaacggcgtgggtttgctggcagagcagagcgccacgccggcc
atcggcgaatcggatatctccgccaatgcccagttcggtatccgcaacaccagcccagcc
agcattgtccaggcccaaggtaactggtggggtcatgccagcggcccgcgcgatgcggtg
gccaaccctgcaggccagggcaatgccgtcagcacgggcgtggactatggttcctacctg
acggccgagcccgtactggcctgcgccatcgtgcccacgcaaggctatgccgcgcgcgtg
cgtgtcgtggagctgcgccttgattgcccgcaggctgctcagtaccgcctgcaggaaagc
gatccgttcgacggcgtcgcatggcagaacatggtgggccaccccacgctggccagctac
acgctgtccatgggcgcgggcgacaagatgatccatgtgcagttccgtacggcacagggc
ggtatcaaccagttctcgctggcgcaacccattgcctacgcaccggaaggtcctttggtg
cagttcgcccagccggccgctggtgccgtgctggagcaggacacggccatcgccatcaat
gtgaccgaccctgaaggcgtgcagcaggtggagatcctggtcgatggccagcgccttgcc
ttgctgacccagccccccttccagaccacctgggcattggctgccgtgcgcaacggcaac
tacacgctgcaggccagggccactaacggcatcggcctgagcaataccgcaacgcgaccg
gttcaggtacagaaaaaggccgggcaaggtcctgccctcaccgccacctttgcaggcacc
gcgcttgtgcccaatgccgccatttccgccgcaggcgaattggccgtgtccgcgcaaagc
cccatcggcatcgccagcgtcaaggccaccatcaacggcctgcagatcttcgagcgcagc
ggcggcagtaccagcccgttcagccacagccagttcatcgactttgcgcaactgcccaat
ggcgtgcaccggttcggcatcaccgccaccgatgtggatggggtctcggccgtgctggac
atcccgttcacgctcagcctcagcgcgccgccggcccctgtcattgcgcagcccatcaac
aacgcacaggtgtccactccgcaactgatggtctccggcacagccatggcgggctcgcag
gtgcagctttatctgggcggccaggccgtgggcagcccgatggccgtgccagccaatggc
agcttctccggcagcctgaccttgccggccgaaggcacgcaccgcatcgaggccacggcc
agcaatgcgcgtggcaccagtcccaggagcgcggtggttgccgtgacctataccatcacg
gctccgacggtgaacttcaccgtgccgggccaggatgtctctgttgtcggcagcacggcc
gtaggtgtcgccgcctcggcaccggacggcattgccaaggtcgacttcttcgccaacggc
agcctgatcggctcggccacgcaggctccgtacagcgtgcagtgggacacgtcgggcgtg
gccaacggtgcccttacgctcagggccgtggcctccagcaaggcgggcaagaccggcgag
gccacgcgctccgtcaccgtgaacaacaagccgcccgagcccgagcagcccaagacgccc
tatacgggcacggtcagctccgtcagcccggcggtctcgtatggcgcgcaacgcgtcgtc
attgccggcgccgccgtgtcacgcgccagcggacagcccatgcccaacgcagcattgcgc
atggtgctggacatctcgggcttcaagcggcgcataggcatcgccaccgacgacagcggc
cagtaccgctacgaattcgtgcccacggccaatgacaacggcacctacatcgtctccgtc
atccacccggaagaaaccgccaccacagagcaggggcgcttcaccatcaaccgcctgagc
ttcgacctggccagctaccagctcaccgcgccgcgcggctttgccgccagcatcacggtc
aatgcgcgtgccagcgcgggcacgggcgccaccggcgtgcgctgggccgtggttccggcc
cagcagcccagcggcagcctgccgccgggcatcagcgtggagccgggtgccccggtcaac
gtggctgcaggcgcctcggtgcccatggtcatccgcttcacgggcagtgcatcggccggg
gagacgggcaccgtcgtgctcacggcctacgccagcgagacgggcgacacgccccgcgga
agcttcaccatccactaccggctggtgcaggccctgcccgaactgtttgccaaccccacc
tacatagaaacaggcgtgcagcaggaaaagacggtcaccgagggcatcaccatcggcaac
cgtggcctggtggcggcccaggacgtgaaggtccaactggtggacaaggacggcaaggcc
gcgccttcctggatcttcctgtccagcgccagccacatcggcgccgtggacgtgggcgca
caggtgcccatccaggtcactgcaagcccgggcaaggacgtggccgacggcatctacaac
taccgactgcagatcacggccagcaaccagggcacgggcaccattcccgtctcggtggcc
gtcacgcaaagcgggcagggcgggctgagcttccatgccaccgacctgttcacggaaacg
ctggacgcgggcggcaagcccataccgggcgtggccaacgtgcgcatccgcctgcaaaac
gatgccgtgctcacctatctgcgcaccctcaccacggacgcgcagggcaaggccgtgctc
accgacctgccgcccggcacctacacctaccgggccagcggcccgcgccatgccgacagg
tcgggccgcatcttcgtgcgcccgggcgtcaccacctcggagcgcgtgcacctgcagtac
cagaccatcagcatcgacttcagcgtgacggaaaccaccatcaaggacgagtaccagatc
accctggaagccaccttccagacccaggtgccggcccccgtggtgctgctggagcccctg
tccatcagcctgcccgaactgcaggtgggcgaggaattcacgggcgaactcacgctgacc
aactacggcctgatccaggccgacaaggtcgtcttcacaccgccgcagtccgacgagtac
taccgctacgaattcctggccgacatccccaagaccctggccgccaagcagcgcgtggtc
attccctaccgcatcacggccgtcaagctgcacccacgaagcatgggcttcaggcaggcg
cgctcggcggagatgggggcggtgcagagcatcgtggtgaatgcgcgcaatgcgggcagt
tgcgctgcctacgccatgtgggccacggttgagttggcgtggatctgcgcgaatggcgaa
gaggaatcgcgttctctctcggccactttcaaccggctagttggtagcgcgtgcgtaagt
acaggcattggagggattggcgggaccggaggccatggtgtgggcggtggctctggtggc
tggggcagcagtggcgggaccggtggtggcggaacacccatcgggttgacgcagggctgc
acgccttggtgccttggcggtggttgcagcgctgaaggtagtagtcctggaggggccggg
ggtggaggaactggtggaacaggatttggaggtagccctcctctaaaaggtagttctcct
tggggtgggggggcgggaggagaggggcctggcggtaaacccggcgcaccaggggacggt
gggcaagggccagacggtaccccaggatgcggtgagtaa

DBGET integrated database retrieval system