KEGG   Delftia acidovorans: Daci_5512Help
Entry
Daci_5512         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ABX38141
UniProt: A9BX65
Position
complement(6123539..6127999)
Genome map
AA seq 1486 aa AA seqDB search
MQYSVRTDGSVGVCRRANPLRWQVLAVTALARMADMVKAWQIACLALAWLLVSPSWAQTT
LSGTISSQTVLRASQSPYLMQGDVVLDGDATLTIEPGVTLRMAAGASFLLRKGALQAVGT
PDKPILITSAAATPAPGDWRQWRMAAGTRSAQTLLDHVTIEYGSGVVIESASPSINNTAF
NHHSGPAIGVDLASSPAGKGNSAKGNSLNAIAVPSGTIRSQVIWGMVGIPYLVQQGLIQI
GQAPLSIEPARLRLSPGVVAMLRVSLNAPAPAQGLVVDITSSVPSVASAVSRVTVAPGQT
SADLEVQASTLGATRITASHATLGFAETQIEVVNLPSLSLVPGSPTVGVNRPYAMTVSLP
APAPVGGVSVQLGNSDANVLSVPSSVLIPAGLQGASFEVTGLAEGSSRLTAQAEGHASAL
ATVSVRGKALVLPASVIVAPGAQASVTLETTEPAPSAGLAVSLAPEQAGLAQVPASVQIP
SGQSKAAFTVAGQTLGTTRITATATGYQPAQAVLRVDAISLDTDPAADLVMNEELSRALR
VQLSKAAPQGGVTVSVASRDPAIAGVTPAEVFIPQGQIYATAPITVKALAEGQTVLDIAS
PGLIAKAVKVDVRAKFALRLTRYGGSKLIVGKGLYSYSSELYVERLINGVVSNGADAVTV
NLRCVAAEICETPATVTIPAGQSRAYINVGGLELGSTQIEATAEGATAAMPVPVEVIVPQ
VRIESLDGQRSTSSLRDSFYVVLSVPGAYWSDNQYAIKAMTVQVSLVDQSPAGVVGGIYT
AADGGALVSQLAIGKDRRDTGWGYIERPGAAGTYRVLAQVQGLAEGKSEVQTVVAANQAL
RLTRYGGSKLIVGKGLYSYSSELYVERLINGVVSNGADAVTVNLRCVAAEICETPATVTI
PAGQSRAYINVGGLELGSTQIEATAEGATAAVPVPVEVTVPQVRIESLDGQRSTSSLRDS
FYVVLSVPGAYWSDNQYAIKAMTVQVSLVDQSPAGVVGGIYTAADGGALVSQLAIGKDRR
DTGWGYIERPGAAGTYRVLAQVQGLAEGKSEVQTVVAANQALRLTRYGGSKLIVGKGLYS
YSSELYVERLINGVVSNGADAVTVNLRCVAAEICETPATVTIPAGQSRAYINVGGLELGS
TQIEATAEGATAAMPVPVEVIVPQVRIESLDGQRSTSSLRDSFYVVLSVPGAYWSDNQYA
IKAMTVQVSLVDQSPAGVVGGIYTAADGGALVSQLAIGKDRRDTGWGYIERPGAAGTYRV
LAQVQGLAEGKSEVQTVVAANQALRLTRYGGSKLIVGKGLYSYSSELYVERLINGVVSNG
ADAVTVNLRCVAAEICETPVTVTIPAGQSRAYISVNGMETGSTQIEASAAGMDAVYINAE
TVAATLRLQSVPSSLKTGQKATSIHVSAEVPGAYWATNQYPSVPVTITFTSSVPSVGTIT
DSVTWNANSGNSAYATFTAVAPGTTQITASSPGFTPATSAPITVNP
NT seq 4461 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacagcgtgcgaacggatgggtctgtgggtgtgtgtagaagagcgaatcctctg
cgttggcaggtcctggccgtgaccgcgctggcccgcatggcagacatggtgaaggcatgg
cagattgcctgtcttgcgctggcatggctgctggtctctccctcctgggcccagaccacg
ctgagcggcaccatctccagccaaacggtgttgcgtgccagccagtcgccttacctgatg
cagggcgacgtggtgctcgatggcgatgccacgctcaccatcgagccgggtgtgaccctg
cgcatggctgcaggcgccagtttcctgctcaggaagggcgcgctgcaagccgtgggcacg
ccggacaagcccatcctcatcacctcggcggccgcaactccggcccccggggactggcgg
caatggcgcatggcggcaggcacgcgcagcgcccagacgctgctggaccacgtcaccatc
gaatacggcagcggcgtggtcatcgagagcgcctccccctccatcaacaacacggccttc
aatcaccacagcggcccggccatcggcgttgatcttgcgtcctcgccagccggcaagggc
aattcggcaaagggcaactcgctgaacgccattgcagttccttcgggcaccattcgctcc
caagtcatctggggcatggtcggtattccctatctggtgcaacagggccttattcagata
ggccaggcgcccttgtctatcgagcctgccaggctccggctcagtcccggtgtggtcgcc
atgctgagggtctcgctcaacgcacctgcacctgcacaaggcttggtcgttgacatcacc
agcagcgtgccctcggtggcttcggccgtgtcgcgggtcaccgtggctccggggcagacc
agtgcggacctggaggtgcaggccagcaccctgggcgccacccgcatcaccgcaagccac
gccacactgggctttgccgaaacgcagatcgaagtcgtcaatctgccctcgctgagcctt
gtccctggcagtcctaccgtcggtgtcaaccggccctatgccatgaccgtgtcgttgccc
gcgccggcacccgtcggtggtgtaagcgtgcagttgggcaactccgacgccaacgtgctc
tctgttccatcgtccgtgttgattccggccggtctacaaggcgccagcttcgaagtgacg
ggccttgccgagggcagcagccggctgacggcccaggccgaaggccatgccagtgccctg
gcaacagtctccgtgcgtggcaaggcattggtcctgcccgccagcgtcatcgtcgcgccc
ggtgcacaggccagcgtgacactggagaccactgagcctgctccctcggcagggctggcc
gtgagccttgcaccggagcaggcaggactggcacaggtcccggcgtccgtgcagattccc
tcgggccagagcaaggcggccttcacggtggcaggccagaccctgggtacgacccggatc
acggccactgccaccggctaccagccggcgcaggccgtgctgcgcgtggatgccatcagc
ctcgacacggacccggccgctgatctggtcatgaatgaggaactcagtcgggccctgcgt
gtgcagttgagcaaggcggctccgcaaggtggtgtcacggtgtcggtggccagccgtgac
ccggcgattgccggtgtgacccccgccgaggtgttcattccccagggtcagatctatgcg
accgccccgatcacggtcaaagcgctggctgaggggcagacggtgctggatatcgcgtcg
ccggggttgattgccaaggcggtgaaggtggatgtgcgggcgaaatttgcgctgaggctc
acacgctacggaggcagcaagctgatcgtgggcaaggggctgtacagctacagcagcgag
ctgtatgtggagcgcctgatcaacggtgtggtcagcaatggtgcggatgcggtgacggtg
aacctgcgctgcgtggcggcggagatctgcgagacgccggcgacggtgacgattcctgca
gggcagagccgggcctacatcaacgtgggtggcctggagctgggttccacgcagatcgag
gcgacagcggaaggggctacagcggccatgcctgtgccggtggaggtcatcgtgccgcaa
gtgcgaatagaaagcctggacgggcagcgttcgacatccagcctgcgggacagcttctat
gtggtgctgagcgtgcctggcgcgtactggtctgacaaccagtatgcgatcaaggcgatg
acggtgcaggtgagcctggtggaccagagtcctgcaggcgtggttggaggcatctacacc
gctgccgatggaggagctctggtttcgcagcttgcgattggcaaggaccgcagggacacg
gggtggggctacatcgagcggcccggtgcagcgggaacctaccgggttctggcgcaggtg
caaggactggccgagggcaagtcggaggtgcagaccgtggtagctgcaaaccaggcgctg
aggctcacacgctacggaggcagcaagctgatcgtgggcaaggggctgtacagctacagc
agcgagctgtatgtggagcgcctgatcaacggtgtggtcagcaatggtgcggatgcggtg
acggtgaacctgcgctgcgtggcggcggagatctgcgagacgccggcgacggtgacgatt
cctgcagggcagagccgggcctacatcaacgtgggtggcctggagctgggttccacgcag
atcgaggcgacagcggaaggggctacagcggccgtgcctgtgccggtggaggtcaccgtg
ccgcaagtgcgaatagaaagcctggacgggcagcgttcgacatccagcctgcgggacagc
ttctatgtggtgctgagcgtgcctggcgcgtactggtctgacaaccagtatgcgatcaag
gcgatgacggtgcaggtgagcctggtggaccagagtcctgcaggcgtggttggaggcatc
tacaccgctgccgatggaggagctctggtttcgcagcttgcgattggcaaggaccgcagg
gacacggggtggggctacatcgagcggcccggtgcagcgggaacctaccgggttctggcg
caggtgcaaggactggccgagggcaagtcggaggtgcagaccgtggtagctgcaaaccag
gcgctgaggctcacacgctacggaggcagcaagctgatcgtgggcaaggggctgtacagc
tacagcagcgagttgtatgtggagcgcttgatcaacggtgtggtcagcaatggtgcggat
gcggtgacggtgaacctgcgctgcgtggcggcggagatctgcgagacgccggcgacggtg
acgattcctgcagggcagagccgggcctacatcaacgtgggtggcctggagctgggttcc
acgcagatcgaggcgacagcggaaggggctacagcggccatgcctgtgccggtggaggtc
atcgtgccgcaagtgcgaatagaaagcctggacgggcagcgttcgacatccagcctgcgg
gacagcttctatgtggtgctgagcgtgcctggcgcgtactggtctgacaaccagtatgcg
atcaaggcgatgacggtgcaggtgagcctggtggaccagagtcctgcaggcgtggttgga
ggcatctacaccgctgccgatggaggagctctggtttcgcagcttgcgattggcaaggac
cgcagggacacggggtggggctacatcgagcggcccggtgcagcgggaacctaccgggtt
ctggcgcaggtgcaaggactggccgagggcaagtcggaggtgcagaccgtggtagctgca
aaccaggcgctgaggctcacacgctacggaggcagcaagctgatcgtgggcaaggggctg
tacagctacagcagcgagttgtatgtggagcgcttgatcaacggtgtggtcagcaacgga
gcggatgcggtgacggtgaacctgcgctgcgtggcggcggagatctgcgagacaccggtt
acggtgacgattcctgcagggcagagccgggcctacatcagcgtgaacggtatggagaca
ggttccacgcagatcgaagcctctgctgcaggaatggacgccgtctatatcaacgcggaa
acggtggcagcgacgttgcgcctccagtctgttccctcctcgttgaaaactgggcagaaa
gcgacctccatccatgtctctgctgaagtgccaggggcttactgggctaccaaccagtac
ccgtcggtccccgtgaccatcaccttcaccagctccgtcccctccgtaggcacgatcacc
gacagcgtgacctggaatgccaactcgggcaactcggcctacgccacgttcacggcggta
gctcccggcaccacccagatcacggccagctcgcccggcttcacgccggccaccagtgca
ccgatcacggtgaatccataa

DBGET integrated database retrieval system