KEGG   Delftia acidovorans: Daci_5513Help
Entry
Daci_5513         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX38142
UniProt: A9BX66
Position
complement(6128046..6128996)
Genome map
AA seq 316 aa AA seqDB search
MRLRRFCGAGLAHAVAVCAAVLVAAPLRAQTDAEPQSCRADAHAVRDARAAESPVTWPRQ
VPPLALTPSCWMSPAEWRQRLVSPGAQAAMLVDVRPAQHRRATPIAQALQMDLPQLQGKR
FLMQEEVILLGTGLDHADLDAACRQLRSQGFGRVKALLGGAAVALHPTASARLQDLSASD
WIASLGQGLAWTVLSLSKALDAAPAVQSPVDEQQTHRLDATHDLAIQLNAIASRKARGDQ
PGVSASRALVFIADASTEPELRARLAAQRASLGERPDAVPVYWLLGGWQAYQAQVASMQA
IGTTAGHRLQAACGRF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcgtcgtttttgtggcgctggcctggcgcatgcagtggcggtgtgcgcagcc
gtcctggtggctgcaccattgcgggcgcagaccgatgccgagccgcagtcctgtcgggca
gacgcgcatgccgtacgggacgcaagggccgccgagtcccctgtgacgtggccccgtcag
gtgccgcctctggcgttgaccccttcctgctggatgagtccggccgagtggcggcagcgc
cttgtttcccctggcgcacaggcggccatgctcgttgacgttcggccggcgcagcacagg
cgcgctacccccatcgcgcaggccctgcagatggatttgccgcagctgcaaggcaagcgc
tttctgatgcaggaggaagtcatcctgctgggcaccgggctggaccatgcggaccttgac
gcggcatgccggcaattgcgcagccagggctttggccgtgtgaaggctttgctgggcggc
gcggcggtggccctgcatcccacggcatcggccaggctgcaggacctgtccgccagcgac
tggatcgccagtctggggcagggcctggcgtggacggtgctgtccctcagcaaggccctg
gatgcagcgccggctgtgcagtcacccgttgacgaacaacaaacgcaccggctggacgcc
acacacgatctggccatccaactgaacgccatagccagccgcaaggcacgcggcgaccag
ccaggagtctccgcgtcccgggccttggtgttcatagccgacgcttcgacggagcctgag
ttgcgtgcccgattggccgcgcaacgggcctctttgggtgagcggcctgacgcagtgccc
gtgtactggctgctgggcggctggcaggcctatcaggcccaggtggcgagcatgcaggcc
atcgggacaacagcgggccaccgacttcaggcggcatgcgggcggttttga

DBGET integrated database retrieval system