KEGG   Delftia acidovorans: Daci_5525Help
Entry
Daci_5525         CDS       T00620                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX38154
UniProt: A9BX78
Position
complement(6142792..6143463)
Genome map
AA seq 223 aa AA seqDB search
MAPGAEPGDPAKEALALCFAAHGLPCEEYNGWLLPGGQAPGVLADWRGAYLGHPLVGSLA
VVVRLPDGHEIIENFTGLGEGLQGMHDAFGHFAVSDLHVMLSALWTARDEDAVPAEAWQV
QGRHWQAYPGPWHLRNDAPLPEGITERLRALIEAEALDKDEDLHWFRFFVGQNNGDFTIE
ALKDNQKWPSAEALLRGQDWPLRDGYYGARLFLILKHGCETAC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccccaggggctgagcccggcgatccggcgaaggaggcgcttgcgctgtgtttcgcc
gcgcatggcctgccctgcgaggaatacaacggctggctgctgcctggcggccaggcacca
ggcgtgctggctgattggcgcggtgcctacctcggccatcccctggtcggttccctggcc
gtggtggtccgcctgccggacgggcacgagatcatcgagaatttcacgggcctgggtgaa
ggcctgcagggaatgcacgacgcattcggccacttcgctgtcagcgacctgcatgtgatg
ctctccgccctgtggacggcgcgcgatgaggatgccgtgccagccgaggcctggcaggtc
cagggcaggcactggcaggcctatccgggcccctggcatcttcgcaacgatgccccgctg
cccgaaggcatcactgagcgcctgcgggccttgatcgaggccgaggcgctggacaaggac
gaggatctgcactggttccgcttctttgtcgggcagaacaatggtgatttcaccattgaa
gcgctcaaggacaatcagaagtggcccagcgctgaggccctgctgcgcggccaggactgg
cccctgcgcgacggctactacggcgcgcgcctgttcttgatactgaagcacggctgcgag
acggcctgctag

DBGET integrated database retrieval system