KEGG   Delftia acidovorans: Daci_5526Help
Entry
Daci_5526         CDS       T00620                                 

Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
dac  Delftia acidovorans
Pathway
dac00340  Histidine metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Daci_5526
Enzymes [BR:dac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     Daci_5526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-ProteinID: ABX38155
UniProt: A9BX79
Position
complement(6143447..6144097)
Genome map
AA seq 216 aa AA seqDB search
MTITIALSKGRIYDETVPLLAAAGISVSEDIEKSRKLIFETNKSDVRVVLVRASDVPVYV
QYGGADLGVAGLDSLIEHGAQGLYQPLDLKIARCRVSVAVRNGFDYALAVKQGARLRIAT
KYPEIARNFFATKGVHVDMVKLYGSMELAPLTGMADAIVDLVSTGNTLKANDLVEVEPIM
EISSRLVVNQAALKLKREPLRHIIDAFAEAVNGPRG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcacgattgccctgtccaagggccgtatctacgacgaaaccgtgccgctgctg
gccgctgccggcatctcggtcagcgaagacattgaaaagtcgcgcaagctgatcttcgag
accaacaagagcgacgtgcgcgtggtgctggtgcgcgcctccgacgtgccggtctatgtg
cagtacggcggcgccgatctcggcgtggccggcctggattcgctgatcgagcatggcgcc
cagggcctgtaccagcccctggacctgaagatcgcgcgctgccgcgtcagcgtggccgtg
cgcaacggcttcgactatgcgctggccgtcaagcagggcgcccgcctgcgcatcgccacc
aagtaccccgagatcgcgcgcaacttctttgccaccaagggcgtgcacgtggacatggtc
aagctctacggctccatggagctggccccgctgaccggcatggccgacgccatcgtcgac
ttggtgtccaccggcaacacgctcaaggccaatgacctggtcgaggtcgagcccatcatg
gagatcagctcgcgcctggtggtcaaccaggcggcgctcaagctcaagcgcgagccgctg
cgccacatcatcgatgccttcgccgaggcggtaaatggccccaggggctga

DBGET integrated database retrieval system