KEGG   Delftia acidovorans: Daci_5531Help
Entry
Daci_5531         CDS       T00620                                 

Definition
(GenBank) sulfate transporter/antisigma-factor antagonist STAS
  KO
K07122  phospholipid transport system transporter-binding protein
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
Module
dac_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_5531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5531
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    Daci_5531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS_2 STAS
Motif
Other DBs
NCBI-ProteinID: ABX38160
UniProt: A9BX84
Position
complement(6147590..6147871)
Genome map
AA seq 93 aa AA seqDB search
MLQLPRELTYRQARSCLVQLRPQVQAFDGAQVRVDASGVEVFDSAALAVLLACRRTAKAA
DKQLVVVGLPQGLQSMAALYGVDGLLTDASSPS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctcccccgtgaactgacctaccgccaggcgcgcagctgccttgtgcagctg
cggccccaggtgcaggctttcgatggcgcccaggtgcgcgtcgatgccagcggcgtcgag
gtcttcgactcggccgccctggccgtgctgctggcctgccgccgcaccgcgaaggcggcc
gacaagcaattggtggtcgtgggcttgccgcagggcctgcagtccatggcggcgctgtac
ggcgtcgacgggctgctgaccgacgcctcctccccctcctga

DBGET integrated database retrieval system