KEGG   Delftia acidovorans: Daci_5536Help
Entry
Daci_5536         CDS       T00620                                 

Definition
(GenBank) ABC transporter related
  KO
K02065  phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
Module
dac_M00210  Phospholipid transport system
dac_M00669  gamma-Hexachlorocyclohexane transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_5536
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5536
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    Daci_5536
   Phospholipid transporter [MD:M00210]
    Daci_5536
   Mce system transporter [MD:M00670]
    Daci_5536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase ABC_ATPase BCA_ABC_TP_C AAA_22 AAA_25 AAA_29 SbcCD_C AAA_30 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABX38165
UniProt: A9BX89
Position
complement(6150759..6151688)
Genome map
AA seq 309 aa AA seqDB search
MFISWGGEQAAAPVCTIAALPANIYRPHHSMIPTASFVELRNVTFGYGERVILRDLSLQV
PRGKVTALMGASGGGKTTVLRLIGGQQHAQQGQVLFDGKDVTTMDAAGLYAARRRMGMLF
QFGALFTDMSVFDNVAFPLREHTDLPDELVRDIVLMKLHAVGLRGARDLMPSEISGGMAR
RVALARAIALDPELIMYDEPFAGLDPISLGTAAQLIRELNDAMGLTSILVSHDVEETFHV
ADHVVILGNGGVAAQGSPDEVRANPDPLVQQFIHARATGPVPFHYPGVSAEEDFGNPASS
GKSNGRRHA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctcgtggggtggtgagcaggcagcagcgcctgtctgcacaatagcggccttg
ccagcgaacatttatcgaccgcaccacagcatgatcccaaccgcctctttcgtggagttg
cgcaacgtcaccttcggctatggcgaacgtgtgatcctgcgcgacctgtcgctgcaggtg
ccgcgcggcaaggtcacggccctgatgggggcatcgggcggcggcaagaccacggtgctt
cgcctgatcggcggccagcagcatgcccagcaggggcaggtgctgttcgatggcaaggac
gtcaccaccatggacgccgcaggcctgtacgccgcgcgccggcgcatgggcatgctgttc
cagttcggcgcgctgttcaccgacatgagcgtgttcgacaacgtggccttcccgctgcgc
gagcacaccgatcttcccgacgaactggtccgcgacatcgtgctcatgaagctgcatgcc
gtgggcctgcgcggtgcgcgcgacctcatgcccagcgagatctcgggcggcatggcccgc
cgcgtggcgctggcgcgggccattgcgctggaccccgaactgatcatgtacgacgagccc
ttcgccgggctggaccccatctccctgggcacggccgcccagctgatccgcgagctcaac
gacgccatgggactgacctccatcctggtgtcccatgacgtggaggaaaccttccacgtg
gccgaccatgtggtcatcctgggcaacggcggcgtcgccgcccagggctcgccagatgag
gtgcgggccaatcccgacccgctggtgcagcagttcatccacgcacgggccaccggtccc
gtgcctttccactaccccggcgtgagcgccgaggaagatttcggcaaccccgcaagctcc
ggcaagagcaacggcaggaggcacgcatga

DBGET integrated database retrieval system