KEGG   Delftia acidovorans: Daci_5546Help
Entry
Daci_5546         CDS       T00620                                 

Definition
(GenBank) putative signal peptide protein
  KO
K21006  polysaccharide biosynthesis protein PelA
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_114 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ABX38175
UniProt: A9BX99
Position
complement(6164257..6167085)
Genome map
AA seq 942 aa AA seqDB search
MNAFLRTCLFCWGVLCGWAVQAAEPAVAVYYGNKASLSELSLYDIAVVEPGHGYDPVQFR
KQAPGSELYAYASVAEVLPERAYFSKIPEAWKMARNGAWQSIVLDQTPAQWPAFFADEVI
APLWKQGFRGFFLDTLDSYRLAANFDEKAQQDGLVRVIETLHQRYPGIRLILNRGFEIVP
RVRDKVQMVAAESLLRGWDASLKRYVNVPEKDREWLLQQLQTIRERDRLPVLSIDYVAPH
DRDATRETARRIAQLGVIPWVSDAGLQTLGIGQVEAVARRVLILYNGADYPSINGASAHR
FLEMPINYMGYVADYADVREPLPEGVARDRYAGVVSWFGGAVPEMRAKSVRQWLANQVQQ
GMPLLVLNTLGLSQDRTMSAALGTRSTEAAPVFPLRRAEQAPLMGFEIPPAEPAHDYEGW
EFTPQMAKGSRELLSFDDKRGRRFVSAAITPWGGFALMPYVVVSMPGTDQSRWVIDPFAL
LREALRLKDFPAPDVSTENGRRLLVAHVDGDGFPSRAELPGTPFAGEVLRREILERYKIP
HTISVIEAEVSPQGLYPQWAEQLEGIAKRIFAMPHVEIASHSYSHPFFWEPGAAPNEDDS
KEVNLNLHIPGYQMDMNREINGSVDYIRKRLAPPGKPVDVFLWTGNTAPSAEALAISDAA
GLLNMNGGDTAITRSNPSLTEVRSWGLRKGGHLQIYAPVTNENIYTNLWHGPFYGFERVI
ETFEMTEAPRRLKAVDIYYHSYSASKQASIKALHRIYQWALAQRLNPVYSSEYIRKVQDF
YEFAIGRDAQGWRLRGPGQLRTLRMPPGMALPSMAASSGIAGYAKGADGSYLHLAGSAGY
LVQQTQQDAAGAAAHAARPYLVDANARLTQWQPQADGGVRFALQGHVPLELRMYLPAGCS
LSSANAATPLLAVAGADTGNANLRSFRSTQNSVELQAQCRGL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctttcctgcgaacctgcctgttttgctggggggtgctgtgcggctgggcggtg
caggccgccgagccggcggttgccgtctattacggaaacaaggcctcgctcagtgaactg
agcctctacgacatcgccgtcgtggagccgggccacggctacgaccccgttcaattccgc
aagcaggctccgggcagcgaactctacgcatatgcctccgtggccgaggtgctgcccgag
cgcgcctacttcagcaagattcccgaggcctggaagatggcgcgcaacggcgcctggcag
tccatcgtcctggaccagacgcctgcccagtggcctgccttcttcgccgacgaggtgatc
gcaccgctgtggaagcagggctttcgcggcttcttcctggacacgctggactcctaccgc
ctggccgcgaatttcgacgaaaaggcccagcaggacggcctggtgcgcgtcatcgagacg
ctgcaccagcgctatcccggcatccgcctgatcctgaaccggggcttcgagatcgtgccg
cgcgtgcgcgacaaggtgcagatggtggcggcggagtcgctgttgcggggctgggatgcc
agcctcaagcgctatgtgaacgtgcccgagaaagaccgcgaatggctgctgcagcaactg
cagaccatccgcgagcgtgaccgcctgccggtgctgtccatcgactacgtggccccgcac
gaccgcgatgccacgcgcgagaccgcccgccgcattgcgcagctgggcgtcatcccctgg
gtgtcggatgcaggcctgcagaccctgggcataggccaggtggaggcggtggcgcgcagg
gtgttgattctctacaacggtgcagactatccgtccatcaacggcgcatcggcgcaccgc
tttctggaaatgcccatcaactacatgggctacgttgccgactacgccgatgtgcgcgag
cccctgcctgaaggcgtggcgcgtgaccgctatgccggcgtggtgagctggttcggcggc
gcggtgcccgagatgcgggccaaaagcgtgcggcagtggctggccaaccaggtgcagcag
ggcatgccgctgctggtgctcaacacgctgggcctgtcacaggaccgcaccatgtcggcc
gccctgggcacgcgcagcacggaagcggcacccgtgttcccgctgcggcgcgccgagcag
gcgccactcatggggttcgagataccgccggccgagcccgcgcacgactacgaaggctgg
gagttcacgccgcagatggccaagggcagccgcgagctgctgtccttcgacgacaagcgg
gggcgccgcttcgtctctgccgccatcacgccctggggcggctttgcgctcatgccctat
gtggtggtgagcatgccgggcaccgaccagtcgcgctgggtgatcgatcccttcgcgctg
ctgcgcgaggcgctgcgcctgaaggatttccccgcgcccgatgtctccacggagaacggc
cgccgcctgttggtggcccatgtggatggcgacggctttccctccagggccgagctgcct
ggcacgccgttcgccggtgaagtgctgcgccgcgagatcctggagcgctacaagatcccg
cacaccatctcggtcatcgaggccgaggtctccccgcagggcctgtatccgcagtgggcc
gagcagctggagggcattgccaagcgcatcttcgccatgccccatgtcgagatcgccagc
cattcctactcgcaccccttcttctgggagcccggggcggcgcccaacgaggacgacagc
aaggaggtgaatctcaacctccacatccccggctaccagatggacatgaaccgggagatc
aacggctcggtcgactacatccgcaagcgcctggcaccgcccggcaagccggtggacgtg
ttcctgtggaccggcaacacggcgcccagcgccgaggccctggccatctccgatgccgcc
ggcctgctcaacatgaatggtggcgacacggccatcacgcgcagcaatccctcgctgacc
gaggtgcgcagctggggtctgcgcaagggcggccacctgcagatctatgcgcccgtcacc
aacgagaacatctacaccaacctctggcacgggccgttctacggcttcgagcgcgtcatc
gagaccttcgagatgaccgaggctccccggcgcctgaaggccgtggacatctactaccac
tcctactccgccagcaaacaggccagcatcaaggcgctgcacaggatctaccagtgggcg
ctggcgcagcggctgaacccggtctacagctccgagtacatccgcaaggtgcaagatttc
tacgaattcgccatcggccgcgacgcgcagggctggcgcctgcggggtccgggccagctg
cgcacgctgcgcatgccgcccggcatggccctgccttccatggctgccagcagcggcatt
gccggctatgccaagggggcagacggcagctacctgcacctggccggcagcgccggatac
ctggtgcaacagacgcaacaggacgccgcaggcgcggccgcccacgcggcgcgcccctat
ctggtggatgccaatgcccggctcacgcaatggcagccccaggccgacggcggcgtgcgc
ttcgccctgcagggccatgtgccgctggagctgcgcatgtacctgcctgccggctgttcg
ctgagttccgcgaacgccgccacgcccctcctggccgtggcgggggccgataccggcaac
gccaacctccgttccttcagaagtacccaaaacagtgtcgaactccaagcgcaatgccgg
gggctctga

DBGET integrated database retrieval system