KEGG   Delftia acidovorans: Daci_5547Help
Entry
Daci_5547         CDS       T00620                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
dac  Delftia acidovorans
Pathway
dac00052  Galactose metabolism
dac00520  Amino sugar and nucleotide sugar metabolism
dac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Daci_5547
   00520 Amino sugar and nucleotide sugar metabolism
    Daci_5547
Enzymes [BR:dac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     Daci_5547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR NAD_binding_10 adh_short NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ABX38176
UniProt: A9BXA0
Position
6167321..6168331
Genome map
AA seq 336 aa AA seqDB search
MILVTGGAGFIGSHTCVELAAAGEPYLIYDNFSNSSPDVLERMERITGRRPLCVEGDVRD
RAALDRLFAEHSIREVIHFAALKAVGESVAQPLRYYEHNVGGTVALLQAMRMAGVRSLVF
SSSATVYGDPASLPIREDFPLSATNPYGRSKLWIEEMLADLDRAEPGQWSLARLRYFNPV
GAHESGLIGEDPRDIPNNLMPYVSQVAIGQRQQLSVYGDDYATPDGTGVRDYIHVTDLAR
GHLAALRYLREQQGLLTVNLGTGRPVSVLEMVKAFERASGRPVPYQIVARRPGDVAQCWA
DPAEAERLLGWKAMLDLDRMCEDAWRWQSQAAGLKR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgattctggtcacaggcggcgccggcttcatcggctcgcatacctgcgtggaactcgcc
gctgcgggcgagccctacctgatctacgacaacttcagcaacagcagccccgatgtgctc
gaacgcatggaacgcatcacgggccggcgcccgctgtgcgtcgagggcgacgtgcgcgac
cgcgccgcgctggaccggctgtttgccgagcactccatccgcgaggtgatccacttcgcc
gcgctcaaggccgtgggcgagtccgtggcccagccgctgcgctactacgaacacaacgtg
ggcggcacggtggccctgctgcaggccatgcggatggcgggcgtgcgcagcctggtgttc
tcctcctcggccacggtctacggcgatccggccagcctgccgatccgcgaagactttccg
ctgtccgccaccaacccctacggtcgcagcaagctgtggatcgaggaaatgctggccgat
ctggaccgggccgagcccggccagtggagcctggcacggctgcgctacttcaaccccgtg
ggcgcccatgaaagcggcctgatcggcgaggacccgcgcgacatccccaacaacctcatg
ccctatgtgtcgcaggtcgccatcggccagcgccagcagctcagtgtctatggcgatgac
tatgcgacgccggacggcacgggcgtgcgcgactacatccacgtcaccgacctggcgcgc
ggccacctggcggcgctgcgctatctgcgcgagcagcagggcctgctgaccgtgaacctg
ggcacggggcgcccggtctcggtgctggagatggtcaaggccttcgagcgcgccagcggc
cgtcccgtgccctaccagatcgtggcgcgccgccccggcgacgtggcccagtgctgggcc
gaccccgccgaggccgagcggctgctgggctggaaggccatgctggacctggaccgcatg
tgcgaggacgcatggcgctggcaaagccaggccgcaggcctcaagcgctga

DBGET integrated database retrieval system