KEGG   Delftia acidovorans: Daci_5548Help
Entry
Daci_5548         CDS       T00620                                 

Definition
(GenBank) imidazoleglycerol phosphate synthase, cyclase subunit
  KO
K02500  cyclase [EC:4.1.3.-]
Organism
dac  Delftia acidovorans
Pathway
dac00340  Histidine metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Daci_5548
Enzymes [BR:dac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.-  
     Daci_5548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus NMO ThiG G3P_antiterm DHO_dh
Motif
Other DBs
NCBI-ProteinID: ABX38177
UniProt: A9BXA1
Position
6168408..6169208
Genome map
AA seq 266 aa AA seqDB search
MLAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDGRD
LILPIIESVASQVFIPLTVGGGVRTVEDVRRLLNAGADKTSFNSAAIANPEVINAASDKY
GAQCIVVAIDAKRRTAEDEQRMGADGRAAGPGWDVYSHGGRKNTGLDAVQWAAEMARRGA
GEILLTSMDRDGTKSGFDLKLTRAVSDAVPVPVIASGGVGSLDDLADGVTLGGADAVLAA
SIFHYGEFTVGQAKQRMAERGVPVRL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaacgcatcatcccctgtcttgacgtcacgggagggcgcgtcgtcaaaggc
gtgaacttcgtggaactgcgcgatgcgggcgacccggtggagatcgccgcgcgctacaac
gcccagggcgcggacgagctgaccttcctggacatcacggccaccagcgacgggcgcgac
ctgatcctgcccatcatcgagtccgtggccagccaggtcttcattccgctgaccgtgggt
ggtggcgtgcgcaccgtcgaggacgtgcgccgcctgctcaacgcgggcgccgacaagacc
agcttcaactcggccgccatcgccaaccccgaggtgatcaatgcggcctcggacaagtac
ggcgcgcaatgcatcgtcgtggccatcgatgccaagcggcgcacggccgaggacgagcag
cgcatgggcgccgatggccgcgctgccggccccggctgggacgtgtacagccacggcgga
cgcaagaacacaggcctggacgccgtgcagtgggccgccgaaatggcgcgccgcggcgcg
ggcgagatcctgctgaccagcatggaccgcgacggcaccaagtccgggttcgacctgaag
ctcacgcgcgccgtcagcgacgctgtgcccgtgcccgtgatcgcctcgggcggcgtgggc
tcgctggacgacttggccgatggcgtgaccctgggcggcgccgacgccgtgctggccgcc
agcatctttcactacggcgaattcaccgtgggccaggccaagcagcgcatggccgagcgc
ggcgtgcccgtgcgcctctga

DBGET integrated database retrieval system