KEGG   Delftia acidovorans: Daci_5550Help
Entry
Daci_5550         CDS       T00620                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
dac  Delftia acidovorans
Pathway
dac00340  Histidine metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Daci_5550
Enzymes [BR:dac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Daci_5550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ABX38179
UniProt: A9BXA3
Position
6169848..6170261
Genome map
AA seq 137 aa AA seqDB search
MNSTTMNDTANTSSQDALARLAAVIESRKPANGGDPDKSYVARLLHKGPDAFLKKIGEEA
TEVVMAAKDADHGGDAGKILYEVADLWFHSMIALAHYGLTPAQVVAELERREGTSGIEEK
ALRKAQERDVNEKGPLP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaattccacgaccatgaacgacaccgcaaacacttcctcgcaggacgccctggcgcgc
ctggccgccgtcatcgaaagccgcaagcccgccaatggcggcgatcccgacaagagctac
gtcgcccgcctgctgcacaagggcccggatgcctttttgaagaagatcggcgaagaggcc
accgaagtggtcatggccgccaaggacgcagaccatggcggagacgccggcaaaatcctc
tacgaagtggccgatctgtggttccatagcatgatcgccctggcccactatggcctgacg
ccagcccaggtcgttgccgagctggagcgccgcgaaggcaccagcggcatcgaggaaaag
gcgctgcgcaaggcccaggaacgtgacgtgaacgagaaaggaccgctgccatga

DBGET integrated database retrieval system