KEGG   Delftia acidovorans: Daci_5554Help
Entry
Daci_5554         CDS       T00620                                 

Definition
(GenBank) twin-arginine translocation protein, TatA/E family subunit
  KO
K03116  sec-independent protein translocase protein TatA
Organism
dac  Delftia acidovorans
Pathway
dac03060  Protein export
dac03070  Bacterial secretion system
Module
dac_M00336  Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Daci_5554
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daci_5554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5554
Secretion system [BR:dac02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   Daci_5554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106 Ni_hydr_CYTB
Motif
Other DBs
NCBI-ProteinID: ABX38183
UniProt: A9BXA7
Position
6172300..6172539
Genome map
AA seq 79 aa AA seqDB search
MGSFSIWHWLIVLAIVVLVFGTKKLKNIGSDLGGAVKGFKDGVKDGSTSTDTPAAAPGQV
AGQTAADKTTIDVEAKQKG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgttttccatctggcattggctgatcgtcctggccatcgtggttctggtgttt
ggcaccaagaagctgaagaacatcggttccgacctcggcggcgccgtcaagggcttcaag
gacggcgtgaaggacggttcgacctccaccgacactcccgcagccgctcccggccaggtc
gccggccagacggctgccgacaagaccaccatcgacgtcgaagccaagcaaaagggctga

DBGET integrated database retrieval system