KEGG   Delftia acidovorans: Daci_5562Help
Entry
Daci_5562         CDS       T00620                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01032  3-oxoadipate CoA-transferase, beta subunit [EC:2.8.3.6]
Organism
dac  Delftia acidovorans
Pathway
dac00362  Benzoate degradation
dac01100  Metabolic pathways
dac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daci_5562
Enzymes [BR:dac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     Daci_5562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABX38191
UniProt: A9BXB5
Position
6183182..6183871
Genome map
AA seq 229 aa AA seqDB search
MSAPTAESKSMSSYQKRSKQELARRVAEDIFDGAYVNLGIGMPTQVANHIPAGREVILQS
ENGILGMGPAPAEGQEDYDLTNAGKQPVTLLPGGCYFHHADSFAMMRGGHLDICVLGAFQ
VSATGDLANWSTGEAGAIPAVGGAMDLAVGARQTWVMMDLLTKTGECKVVEACSYPLTGL
SCVKRIYTDLCTLECTPEGLRLIDTVPGLSHAELQSIVGLPIKDATATA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccaaccgccgaaagcaagagcatgagcagctaccagaaacgcagcaagcaa
gagctggcccggcgcgtggccgaagacatcttcgacggcgcctatgtcaacctgggcatc
ggcatgcccacccaggtggccaaccacatcccggccggccgcgaggtcatcctgcaaagc
gagaacggcatcctgggcatgggcccggcgcccgccgaaggccaggaggactatgacctg
accaatgccggcaagcagcccgtcaccctgctgccgggcggctgctatttccaccatgcc
gacagcttcgccatgatgcgcggcggccacctggacatctgcgtgctgggcgccttccag
gtctcggccacgggcgacctggccaactggagcacgggcgaggccggtgccattcccgcc
gtgggcggcgccatggacctggccgtgggtgcacgccagacctgggtgatgatggacctg
ctgaccaagaccggcgaatgcaaggtcgtcgaggcctgcagctacccgctcacgggcctg
tcctgcgtcaagcgcatctacaccgacctgtgcacgctggaatgcacgcccgagggcctg
cgcctgatcgacaccgtgcccggcctctcgcacgccgagctgcagtccatcgtgggcctg
cccatcaaggacgcgacggccacggcctga

DBGET integrated database retrieval system