KEGG   Delftia acidovorans: Daci_5566Help
Entry
Daci_5566         CDS       T00620                                 

Definition
(GenBank) putative signal peptide protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX38195
UniProt: A9BXB9
Position
complement(6187278..6188081)
Genome map
AA seq 267 aa AA seqDB search
MTLSLPAPRAARHIYAAALLACSVSAAWAAEPAKAAASAPTAAVPADSVARTTAAVQATP
EADLRITYEAMSVGSDGVQRSSVYTNRVYRRKAQLWIEREMPAALRQSQDHGHDHDHAHG
PHAGHAHDEARAAPLSIRRADDGKVGVEVILAKLRRVISVDLAHHGNVGYGGSFDNVYWI
VPPTALQGMERVGKPHNGVQRYRGTAGEQTTVIDWDVANQFARRVERSDSHGTERIVVTA
TKLPAPLAQPWKAIEGYDKGDYSDLLD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgctttcccttccggcgccgcgtgcggcgcgccacatctacgcggccgcgctgctg
gcctgttccgtctccgcagcatgggccgccgagccggccaaggcggcggcatccgcaccc
acggccgcagtccctgcggattccgtggcacgcaccacggccgccgtgcaggccacgccc
gaagccgacctgcgcatcacctacgaagccatgagcgtgggcagcgacggcgtgcagcgc
agcagcgtctataccaaccgcgtctaccgccgcaaggcccagctgtggatagagcgcgaa
atgcccgccgccctgcgccagagccaggaccacggccatgaccatgaccatgcccacggc
ccgcacgccggccatgcccatgacgaggcccgcgccgcacccctgtccatccgccgcgcc
gatgacggcaaggtgggcgtggaagtcatcctggccaagctgcgccgcgtcatcagcgtg
gacctggcccaccacggcaacgtgggctacggcggctccttcgacaacgtgtactggatc
gtgcctcccaccgcgctgcagggcatggaacgcgtgggcaagccgcacaacggcgtgcag
cgctaccgcggcacggcaggcgagcagaccaccgtcatcgactgggacgtggccaaccag
ttcgcccgccgcgtggaacgcagcgactcccacggcaccgagcgcatcgtcgtcaccgcc
accaagctgcccgcaccgctggcccagccctggaaggccatcgaaggctacgacaagggt
gattactccgacttgctggattga

DBGET integrated database retrieval system