KEGG   Delftia acidovorans: Daci_5568Help
Entry
Daci_5568         CDS       T00620                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dac  Delftia acidovorans
Pathway
dac00730  Thiamine metabolism
dac00790  Folate biosynthesis
dac01100  Metabolic pathways
dac02020  Two-component system
Module
dac_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Daci_5568
   00790 Folate biosynthesis
    Daci_5568
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daci_5568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dac04147]
    Daci_5568
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dac00537]
    Daci_5568
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Daci_5568
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daci_5568
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dac00537]
 Enzymes
  Daci_5568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme PglZ Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ABX38197
UniProt: A9BXC1
Position
complement(6189733..6191145)
Genome map
AA seq 470 aa AA seqDB search
MKLKMLCSALAGASLLLSACGGSDGSSAAAPTKNVLFFLGDGMGITTMTAARIYSVGEDG
ELTMDKLPETAFVHTFSNDAQVTDSAPSMAAYMTGVKMNNEVISMTPDTKATDAAGKAYH
TNYDSTCPSGNGQAVPTLLEQMKSAGYGTGVVSTARITHATPATTYSHVCHRDAENTIAA
ALVPGGSGYNSKLGDGVDVILGGGSYYFTPKADGGRRNDSRNLIAEFKTQKYSYAANKSE
FDKLPVDGSKIAGLFTKDHMAYDLDRDATKEPSLAEMTGKAIDALSAKKKGFFLMVEGGR
IDHALHATNARRALQDTVAFDNAIQTALDKMAKLDPGLKNTLIVVTADHDHTLHLNGYAA
RTGKTEAGKPGVLGLVKNYVDGKASTDVDGNPYTILGFGNGPKRLATRGPIDAASLESPD
YLQEAVVPLASETHGGGDVFLGAQGMGADTFSGVIDNTTVFTLIKKSIGL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaagatgttgtgcagcgcgctggctggtgcctcgctgctgttgagcgcctgt
ggcggcagcgacggttcgtccgcagccgctccgaccaagaacgtgctgttcttcctgggc
gatggcatgggcatcaccaccatgaccgccgcgcgcatctacagcgtgggagaagacggt
gagctgaccatggacaagctgcccgagacggccttcgtccacaccttctcgaacgacgcc
caggtgacggacagcgcaccctcgatggccgcctacatgaccggcgtgaagatgaacaac
gaagtcatttccatgacgcccgacaccaaggccacggacgctgcgggcaaggcctatcac
accaactacgacagcacctgccccagcggcaacggccaggccgttcccacgctgctcgag
cagatgaagtccgccggctacggcacgggcgtggtctccaccgcgcgcatcacgcatgcc
acgccggcaaccacctactcgcacgtctgccaccgcgatgcggagaacaccatcgccgcg
gccctggtgcccggcggctccggctacaacagcaagctcggtgacggcgtggacgtgatc
ctgggtggcggctcctactacttcacgcccaaggccgacggcggccgccgcaacgacagc
cgcaacctgatcgccgagttcaagacgcaaaagtacagctacgctgccaacaagagcgag
ttcgacaagctgcccgtggacggcagcaagatcgccggcctgttcaccaaggaccacatg
gcctatgacctggaccgcgatgcgaccaaggaaccgagcctggccgagatgacgggcaag
gccatcgacgcactgtcggccaagaagaagggctttttcctgatggtggaaggcggccgc
atcgaccatgcgctgcacgccaccaacgcgcgccgcgcgctgcaggacacggtggccttc
gacaacgccatccagaccgcgctggacaagatggccaagctcgatccgggcctgaagaac
acgctgatcgtcgtcaccgccgaccatgaccacacgctgcacctgaacggctatgccgcg
cgcaccggcaagaccgaggccggcaagcccggcgtgctgggcctggtcaagaactacgtg
gacggcaaggcctccacggatgtggatggcaatccctacaccatcctgggcttcggcaac
ggtcccaagcgcctggccacgcggggtcccatcgacgcggcctcgctggagagccccgac
tacctgcaggaggccgtggtgcccctggcctccgaaacccacggcggcggcgacgtgttc
ctgggcgcgcaaggcatgggtgccgatacgttctcgggcgtgatcgacaacaccaccgtc
tttacgctgatcaagaagagcatcggcttgtga

DBGET integrated database retrieval system