KEGG   Delftia acidovorans: Daci_5570Help
Entry
Daci_5570         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ_3
Motif
Other DBs
NCBI-ProteinID: ABX38199
UniProt: A9BXC3
Position
complement(6192498..6193475)
Genome map
AA seq 325 aa AA seqDB search
MWRLTEAVVVDGRVYTGGNSLRAYGEADGTLLWGSSFNSGPAVVSQGNVFSYADETTFAP
NRLYVRNAVTGSSVNTPDHYEGQEDRSLLVADDDSVYAPFTFRMTAVDGIVAWRDYAPMR
TLPSRASDRLYMADAANVYARDIKDGREIARIATGGEQREVRRATGTLADGQDRVLVSHF
NQGNASLGSYSIGQKKKLWDVEASFLSRPALAGDTVYVVNVPQPAKGVATLEARSSATGA
VFWSTPLPDAVVPVGEEAVYHVAVVGNLVFVSSDRKFGASTYAIDRSSHAVGWRHPVNGS
LAVSDNGILYVAQALDASLFAINLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtggagactgacagaagccgtcgtggtcgatggacgggtttacacaggcggtaatagc
cttcgtgcctatggagaagccgacggcacgctgctctgggggtcgtcgtttaactctggc
ccagcggttgtcagccagggtaacgtattttcttatgcggatgaaacgacttttgctccc
aatcgtctgtatgtgcgcaatgccgtgactggatcctcggtgaacacgcccgatcactac
gaaggacaggaagaccgctctttgttggttgcggatgatgactcggtctatgccccgttc
accttcagaatgacggctgtggacggtattgtggcgtggcgggattatgcgcccatgcgc
actctgccttccagggcttccgatcggttgtatatggcagatgcggccaacgtctatgcc
cgggatatcaaggatggcagagagatagcgcgcattgcaaccggaggtgagcaaagggaa
gtccgcagggcgaccggtaccctcgccgatggtcaggatcgcgtgctagtctcgcatttc
aaccagggcaatgcctcgcttggcagctactcgattgggcaaaagaaaaaactctgggat
gtcgaggcttcctttctgagccgcccagccttggcgggcgatacggtctatgtagtcaat
gtgccgcagcccgccaagggcgtcgccacgctggaggcgcgttcgtcggcaacaggtgcc
gtgttctggtccacgccgctgcctgatgcagtggtgccggtcggcgaggaggctgtctat
cacgttgctgtggtcggcaacttggtctttgtgtcttctgaccgtaaattcggggcgtcc
acctacgcgattgaccgttccagccatgctgttggctggcgccatcccgtcaatggaagt
ctggcagtttccgacaacggcatcctgtatgtcgcgcaggcgctcgacgccagcctgttc
gccatcaatctgcgttga

DBGET integrated database retrieval system