KEGG   Delftia acidovorans: Daci_5580Help
Entry
Daci_5580         CDS       T00620                                 

Definition
(GenBank) Fimbrial assembly family protein
  KO
K02663  type IV pilus assembly protein PilN
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_5580
   02035 Bacterial motility proteins [BR:dac02035]
    Daci_5580
Secretion system [BR:dac02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Daci_5580
Bacterial motility proteins [BR:dac02035]
 Pilus system
  Pilus assembly proteins
   Daci_5580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilN HemX DUF4472 DivIC DUF4600 ABC_tran_CTD PAP_PilO
Motif
Other DBs
NCBI-ProteinID: ABX38209
UniProt: A9BXD3
Position
complement(6203933..6204544)
Genome map
AA seq 203 aa AA seqDB search
MILINLLPHREATRKRRKEAFQATMVLSALVGLLIIGAVYWWYQMMIEAQQAKNSMLRAE
ITVLESQIKEIAGLEDEITALRARQKAVEDLQSDRNLPVHMLNELVAQLPDGVYLSSIKQ
EGLVVTMQGTAQSNERVSEMLRNLSEGTPWISKPELAEIVAKTVNVTPKDQRRAAAFNLR
FQLTRASVAEKSLSTAANPGKSQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgatcaatctgcttccgcacagagaagcaacacgcaagcgtcgcaaggaagca
ttccaggccaccatggtcctgtcggccctggtggggcttttgatcattggcgcggtgtac
tggtggtaccagatgatgatcgaggcccagcaggcaaagaacagcatgctgcgcgccgag
atcaccgtgctggagtcccagatcaaagaaattgccgggctggaggatgagatcacggcc
ctgcgtgcacgtcagaaggccgtggaggatctgcagtccgaccgcaatcttccggtgcac
atgctcaacgagctggtggcccaactgcccgatggtgtctacctcagcagtatcaagcag
gaaggtctggtcgttaccatgcagggcacggcacagtccaatgagcgggtgtccgaaatg
ctgcgcaatctctcggaggggacgccctggatttccaagcctgaactggcggaaatcgtg
gccaagacggtcaacgtcacgcccaaggaccagcgtcgcgccgctgcgttcaatctgcgc
tttcaactgacgcgcgccagcgtggcggagaagagcctttcgacggcggccaacccagga
aagtcccagtga

DBGET integrated database retrieval system