KEGG   Delftia acidovorans: Daci_5585Help
Entry
Daci_5585         CDS       T00620                                 

Definition
(GenBank) Ferric reductase domain protein transmembrane component domain
  KO
K17247  methionine sulfoxide reductase heme-binding subunit
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Daci_5585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferric_reduct
Motif
Other DBs
NCBI-ProteinID: ABX38214
UniProt: A9BXD8
Position
complement(6209944..6210576)
Genome map
AA seq 210 aa AA seqDB search
MAHAMTAVQHLLLHRTAKPLVFLVCLLPFAWLLAGAILNTLGANPAEALLRSTGDWTLRF
LCVVLAVTPLRQALGLTALARFRRMLGLYVFFYALLHLLCYAWFDMGLDWGEIVLDIPKR
PFILVGFAALLLLTALAVTSPHRVMRAMGGRRWQWLHRCIYAVAPLALLHFFWMRAGKNN
FAEVGVYAAILALLLAWRVVHALRRRRARR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggcccatgcaatgacggcggtgcagcatcttttgctgcaccggacggccaagccgctg
gtgtttcttgtgtgcctgctgccgtttgcgtggctgctggctggagccatcctgaacacg
cttggcgccaatccggccgaggccttgctgcgctccaccggcgactggaccttgcgcttt
ctgtgcgtggtgctggccgtgacaccgctgcgccaggcgctgggactgacggcactggcg
cgcttcaggcgcatgctgggcctgtatgtgttcttctacgcgctgctgcacctgctgtgc
tatgcatggttcgacatggggctggactggggcgagatcgtgctcgacatcccgaagcgc
ccgttcattctggtgggctttgcggcgctgctcttgctgaccgctctggcggtgacttca
ccgcaccgtgtcatgcgcgccatgggcggcaggcgctggcagtggctgcaccgctgtatc
tatgcggtcgcgccgctggccctgttgcatttcttctggatgcgcgcaggcaagaacaac
ttcgccgaggtcggcgtgtacgccgccattcttgcgctgctgctggcctggcgcgtggtc
catgcactgcgccgccggcgcgccaggcgctag

DBGET integrated database retrieval system