KEGG   Delftia acidovorans: Daci_5586Help
Entry
Daci_5586         CDS       T00620                                 

Definition
(GenBank) oxidoreductase molybdopterin binding
  KO
K07147  methionine sulfoxide reductase catalytic subunit [EC:1.8.-.-]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_5586
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.-  Acting on a sulfur group of donors
    1.8.-.-  
     Daci_5586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb
Motif
Other DBs
NCBI-ProteinID: ABX38215
UniProt: A9BXD9
Position
complement(6210578..6211558)
Genome map
AA seq 326 aa AA seqDB search
MLIRSHDNGFQHPKGSEITPRAGYLKRRAWLQYLAAGSAGAALPGWAAGVQRPGKLAALA
SVPSQVVGANTMDRVTAYADVSQYNNFYEFGLDKDDPAKNAHTLKTRPWTVKIEGLVQQP
QTLDLDALLKLAPQEERIYRLRCVEGWSMVIPWVGYSLAELLRKVQPLGSAKYVEFVTLA
DKAQMPGLRSGVLDWPYTEGLRLDEAMHPLTLLAFGMYGEVLPNQNGAPVRLVVPWKYGF
KSAKSIVAIRLTDKEPGTAWNKAARNEYGFYSNVNPDVPHPRWSQATERRIGEDGLFAKK
RKTQLFNGYEAQVGQLYAGMDLKKFY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgatccgctcccacgacaacggcttccaacacccgaaaggcagcgagatcacgccc
cgggcaggctacctcaagcgccgtgcctggctgcagtacctggccgcaggctcggcgggc
gcggcattgcccggctgggcggcgggcgtgcagcgccccggcaagctggcagcactggcc
tccgtgccttcccaggtagtgggcgcaaacaccatggaccgtgtcacggcctatgccgat
gtgtcccagtacaacaacttctatgaattcgggctggacaaggacgatcctgccaagaac
gcccacacgctcaagacccgcccctggacggtgaagatcgagggcctggtccagcagccg
cagacgctggacctggatgcgctgctcaagctcgcgccacaggaagagcgcatctaccgg
ctgcgctgcgtggagggctggtccatggtgattccctgggtgggctattccctggccgag
ctgctgcgcaaggtgcagccgctgggcagtgccaagtatgtggaattcgtgaccctggcc
gacaaggcgcagatgccgggcctgcgcagcggcgtgctggactggccttacaccgagggg
ctgcgccttgatgaagccatgcacccgctgacgctgctggcctttggcatgtatggcgag
gtgctgcccaaccagaatggcgcgcccgtgcggctggtcgtgccgtggaagtacggcttc
aagagcgccaagagcatcgtcgccatccgcctgaccgacaaggagccgggcacggcctgg
aacaaggcggcgcgcaacgagtatggcttttattccaatgtgaaccccgacgtgccgcac
ccgcgctggagccaggccacggagcggcgcattggcgaagacggcttgttcgccaagaag
cgcaagacgcagctgttcaatggctacgaagcccaggtgggccagctctacgcgggcatg
gacctcaagaagttctattga

DBGET integrated database retrieval system