KEGG   Delftia acidovorans: Daci_5589Help
Entry
Daci_5589         CDS       T00620                                 

Definition
(GenBank) cytochrome c class I
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABX38218
UniProt: A9BXE2
Position
complement(6215401..6216168)
Genome map
AA seq 255 aa AA seqDB search
MFSSVRRGETRVPDDINHRGPHCRIRRILRFQQQNHALDMKLLASLLTAAILAAAPAFPA
FSAGEAPAAPAQPKAAKADLAKGEASYTAVCAACHAADGNSTIPLQPKLAGQHPEYLVKQ
LLEFKGDKRKDPVMKGFASMLSEPDMKNIAAWLHTQKPKDGFAKDKDLVAMGERIYRGGI
QERNIAACAGCHSPNGAGIPAQYPRLAGQHADYTTTQLTAFRDGKRGNSIQMTQVAAKLN
DREIKAVADYIAGLR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctctgtgcgcaggggcgaaaccagggttcctgacgatatcaatcacagggga
ccccattgtagaatccgccgaattttgcgctttcaacaacagaaccacgccctcgatatg
aagttgcttgcctctttgctgacggctgccattcttgctgcagcccccgcctttcccgct
ttctccgctggcgaggcacctgctgccccggctcagccgaaggcggccaaggccgatctg
gcgaagggcgaggccagctacaccgccgtctgcgcggcatgccatgcggccgacggcaat
tccaccatcccgctgcagcccaagctggccggccagcatcccgagtacctggtcaagcag
ttgctggagttcaagggcgacaagcgcaaggaccccgtgatgaagggctttgccagcatg
ctcagcgagcctgacatgaagaacatcgccgcctggctgcacacgcaaaagcccaaggac
ggctttgccaaggacaaggacttggtggccatgggcgagcgcatctaccgcggcggcatc
caggagcgcaacattgctgcctgcgcgggctgccacagccccaacggcgccggcattcca
gcccagtacccgcgcctggcgggccagcatgccgactacaccacgacccagctcacggcc
ttccgtgacggcaagcgcggcaatagcattcagatgacgcaggttgctgccaagcttaac
gatcgcgaaatcaaggccgtggcagactacatcgctggcctgcgttga

DBGET integrated database retrieval system