KEGG   Delftia acidovorans: Daci_5590Help
Entry
Daci_5590         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding Sigma70_r4 HTH_31 rve_2
Motif
Other DBs
NCBI-ProteinID: ABX38219
UniProt: A9BXE3
Position
complement(6216328..6217260)
Genome map
AA seq 310 aa AA seqDB search
MTSPRRRTPRQRHPELERDFVRTPALGYEDMEGSGLVRCLAHGFPSPLVRWHFHEEYELH
LITHTSGRAFVGDWIGPFEPGHLVLCGPRLPHNWISFDAPDGGSPARDYVILFNHDPIAR
AAEQIPEMREVLQLLDRARHGIEFFGLAQTARAHWDAVRSARGMRRFTAFCALLSDLAEC
TDYRLLSAVQMQGAQGEAQVDQINEVVNRIMARVSEPLSLADVAAELGMSESRFSRFFRR
ATGNSFTDFVSRVRINSACHLLMQTDSFIADICYQVGFNNVANFNRRFLEIKGMTPSEFR
RQADSRFGAG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccacgccgccgcacaccccgccagcgtcaccctgaactggagcgcgatttc
gtgcggacgcccgcgctgggctatgaggatatggagggcagtggcctggtgcgctgcctg
gcacatggtttcccgagccccctggtgcgctggcatttccatgaggagtacgagctgcac
ctcatcacccacacctcgggccgcgccttcgtgggagactggataggacccttcgagccc
ggccacctcgtgctgtgcggcccgcgcctgccgcacaactggatctcgttcgatgcgccc
gatgggggctcgcctgcacgcgattacgtgattcttttcaaccacgaccccatcgcccgt
gcggccgagcagatcccggagatgcgcgaggtgcttcaactgctggaccgtgcgcgccat
ggcatcgagttcttcggcttggcgcagacggcgcgcgcgcactgggatgcggtcaggagt
gcgcgcggaatgcgccgcttcacggccttttgcgcgctgctgtccgatctggccgagtgc
accgactaccggctgctgtcagccgtgcagatgcagggcgcccagggcgaggctcaggtg
gatcagatcaacgaggtggtcaaccgcatcatggcgcgcgtgagcgagccgctgagcctg
gccgacgtggcggccgagctgggcatgagcgagagccgcttcagccgctttttccgccgg
gccacgggcaacagcttcaccgacttcgtcagccgggtacgcatcaacagcgcatgccac
ctgctcatgcagaccgacagcttcatcgccgacatctgctaccaggtgggcttcaacaac
gtggccaacttcaacaggcgcttcctggagatcaagggcatgacgccctcggagttccgc
cgccaggcggacagccgcttcggcgcgggttga

DBGET integrated database retrieval system