KEGG   Delftia acidovorans: Daci_5597Help
Entry
Daci_5597         CDS       T00620                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE domain protein
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
dac  Delftia acidovorans
Pathway
dac00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Daci_5597
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     Daci_5597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL NHL
Motif
Other DBs
NCBI-ProteinID: ABX38226
UniProt: A9BXF0
Position
6224125..6225027
Genome map
AA seq 300 aa AA seqDB search
MAVQRIPVPPSALGESPFWHPQEHRLYWCDIQDRHIHSWEPATGLHRSWATPSEPGCCAP
TDRGRIVVGLRDGFGLLDTATGHTEMIARLDHDPQQLRLNDGRCDRAGRLWAGSLFSPKT
APDAALWCLRADGAGGYAVQRMAGDCTTANGLAFSPDDDWMYWADTPAHRIDRFAFDLDS
GTLGTRSLWKAFAPKAEGRLYGGRPDGASVDVRGNYWVAMYEGGCVLQLSPEGDVLQRLD
TPVRCPTMVCFGGEDLRTLYITSAGHGRPDPERSAQVPAGALMECRVDVPGLPVNSFREA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcagcgcatccctgttccaccgagtgcactcggcgagtcccccttctggcac
ccgcaggaacaccggctctactggtgcgatatccaggaccggcacatccattcgtgggag
cccgccacaggcctgcaccgcagctgggccacgcccagcgaaccgggctgctgcgctccc
acggaccggggccgcatcgtggtggggctgcgcgatggcttcggcctgctggacaccgcc
acgggacacaccgaaatgatcgcccgcctggaccatgatccgcagcagctgcggctcaac
gacgggcgctgcgaccgcgccgggcggctgtgggcggggtcactgttctcgcccaagacg
gcgcccgatgccgcgctgtggtgccttcgcgcggacggcgccggaggctacgccgttcag
cgcatggcaggcgactgcaccacggccaacggcctggccttcagccccgatgacgactgg
atgtactgggcagacacgccagcccaccgcatagaccgctttgccttcgacctggactcc
ggcacgctgggcacgcgctcgctgtggaaggccttcgcgcccaaggccgagggcaggctc
tatggcggccgccccgacggcgccagcgtcgacgtccggggcaactactgggtggccatg
tacgaaggcggctgcgtgctgcaactgagtcccgagggcgatgtgctgcagcgcctggac
acgcccgtgcgctgccccaccatggtctgctttggaggagaggacctgcgcacgctgtac
atcacctcggccggacacggccggcccgatccggagcgatcggcgcaggtgcctgccggc
gcactgatggagtgccgtgtcgatgtgccgggcctgccggtgaacagcttccgcgaagcc
tga

DBGET integrated database retrieval system