KEGG   Delftia acidovorans: Daci_5599Help
Entry
Daci_5599         CDS       T00620                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
dac  Delftia acidovorans
Pathway
dac00030  Pentose phosphate pathway
dac00480  Glutathione metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Daci_5599
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Daci_5599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dac04147]
    Daci_5599
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Daci_5599
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Daci_5599
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Daci_5599
  Exosomal proteins of colorectal cancer cells
   Daci_5599
  Exosomal proteins of bladder cancer cells
   Daci_5599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABX38228
UniProt: A9BXF2
Position
6226765..6228219
Genome map
AA seq 484 aa AA seqDB search
MGFDLVLFGGTGDLAWRKLMPALFQAFRHGTLPEGGRILCVGRDDLSDDQYRALIQGRFE
KVELSKRPSPEEFSRFAALLHYLRMDLSQPADYERLATALNTRGAETVVMYLATAPSLFT
TVCEQIAAVGLNGPQTRVVLEKPLGHDLASNQAINATLRKVLREEQVFRIDHYLGKPSVQ
NLLALRFGNALFEPLWRRETIANIQITIAEELGVESRGAFYDQTGALRDMVQNHALQLLC
AIGMEPPINASAHAIRDEKLKVLQSLKPWTPETLSQHVVRGQYLAGASQGQPVPAYQQEK
GVAAGSQTETFVALRTEICNWRWAGVPFYIRTGKRLAGRDARIVVNFRPVPHPIFRSPLS
EANRLVINLQPKDGLELHLLAQGATQQQAEPSLAPVHLNLDFDQRFGAKRVGAYERLLLD
VIAGRLNLFVRSDEQEQAWRWVEPILQHWRNDLSGPRGYAAGSWGPSAASAMIARDGFCW
SEEV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgatctggttttgttcggtggcacgggtgatctcgcatggcgcaagctcatg
cccgcgctgttccaggcgttccgccacggcaccctccccgaggggggtcgcatcctgtgc
gtgggtcgcgatgatctgagtgacgaccagtaccgcgcgctcatccagggccgcttcgaa
aaggtggaactgtccaagcgccccagtccagaggagttctcgcgtttcgcggccctgctg
cactacctgcgcatggacctgtcgcaacccgccgactacgagcgcctggccacggcgctg
aacacccgcggcgccgagacggtggtgatgtacctggccactgcgcccagcctgttcacc
acggtctgcgagcagattgccgccgtgggcctgaatggcccgcagacgcgcgtggtgctg
gaaaagccgctgggccacgacctggcctccaaccaggccatcaacgccacgctgcgcaag
gtcctgcgcgaagagcaggtgtttcgcatagaccactacctgggcaagccctcggtccag
aacctgctggccctgcgctttggcaacgcactgttcgagccactgtggcggcgcgagacc
attgccaacatccagatcaccattgccgaggaactgggcgtggaaagccgtggcgccttc
tacgaccagaccggcgcgctgcgcgacatggtgcaaaaccatgccctgcaactgctgtgc
gccatcggcatggagccgccgatcaacgcctcggcccacgccatccgcgacgaaaagctc
aaggtgctgcagtcgctcaagccctggacgccggaaaccctgagccagcacgtggtgcgc
ggccagtacctggccggcgccagccagggccagcccgtgcccgcctaccagcaagagaaa
ggcgtggcggccggcagccagaccgagaccttcgtcgccctgcgcaccgagatctgcaac
tggcgctgggccggcgtgcccttctacatccgcaccggcaagcggctggcaggccgggat
gcgcgcatcgtcgtgaacttccggcccgtgccccatcccatcttccgctcgcccctgtcc
gaagccaaccgcctggtcatcaacctgcaacccaaggacggcctggagctgcacctgctg
gcccaaggcgccacccagcagcaggccgagccttcgctggctcccgtgcacctgaacctg
gacttcgaccagcgcttcggcgccaagcgcgtgggcgcctacgagcgcctgttgctggac
gtgatcgccgggcggctgaatctgttcgtgcgtagcgacgaacaggaacaggcctggcgc
tgggtggaacccatactgcagcactggcgcaacgatctctcggggccgcgcggctatgcg
gctggcagttgggggcccagcgcggccagcgccatgattgcgcgggatgggttttgttgg
agcgaggaggtttga

DBGET integrated database retrieval system