KEGG   Delftia acidovorans: Daci_5601Help
Entry
Daci_5601         CDS       T00620                                 

Definition
(GenBank) alpha/beta hydrolase fold
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABX38230
UniProt: A9BXF4
Position
6229231..6230142
Genome map
AA seq 303 aa AA seqDB search
MVTTCIRELPHGIHLHCRVSGEPGRPLLLFLHGFPEDSFIWEGMLEQFGAQWRCVAPDLR
GFGHSSQPAGVEQYKAKHLLQDLAALIAIESPGAPAACVIAHDWGGALAWGLANRHPGLM
QRLMILNAPHPGAFLRELLDNPVQQAASQYMHFLRRPDAPALLADNDWQRMLGFFRTPQG
ELPGWLTPQLQQRYREHWDLGVQGSCHYYGASPLVPPRPEDPDSADALRNLRLPPEMLDI
GVPTHVLWGDSDPALQPALVEGLEPWVPRLTVQHLAGTSHWVVHEQPDAVRQALEQFLSR
PVQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccacctgcattcgcgagctgcctcacggcatccatctgcactgccgcgtcagc
ggcgaacccggccggccgttgctgctgttcctgcacggttttcccgaggacagcttcatc
tgggaaggcatgctggagcagttcggcgcgcaatggcgttgcgtcgcccccgatctgcgg
ggctttggccattccagccagccggccggcgtggagcagtacaaggccaagcacctgctg
caggatctggcggcgctgatcgccatcgaaagccctggcgcacccgcagcctgcgtgatc
gcccacgactgggggggtgccctggcctggggtctggccaatcgccatcccgggctgatg
cagcggctgatgatcctcaacgccccgcatccaggcgcctttctgcgcgagttgctggac
aaccccgtgcagcaggccgcaagccagtacatgcatttcctgcgccgccccgacgcaccc
gccctgctggccgacaacgactggcagcgcatgctgggatttttccgcacaccgcagggc
gagttgcccggctggctcacgccgcagttgcagcagcgctaccgcgagcactgggacctg
ggcgtgcaaggctcctgccactactacggcgccagtcccctggtgccgccccggcccgaa
gacccggactcagccgacgcactgcgcaacctgaggctgccgcccgagatgctggacatc
ggcgtgcccacgcatgtgctctggggcgacagcgacccggcgctgcagcccgccctggtc
gaaggcctggagccgtgggtgccgcgcctgacggtgcagcacctggcaggcacttcgcac
tgggtcgtgcacgagcagccagatgcggtgcggcaagcgctggagcagttcctgtcccgc
cccgttcagtag

DBGET integrated database retrieval system