KEGG   Delftia acidovorans: Daci_5614Help
Entry
Daci_5614         CDS       T00620                                 

Definition
(GenBank) NLPA lipoprotein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
Module
dac_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_5614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5614
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    Daci_5614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 TraF
Motif
Other DBs
NCBI-ProteinID: ABX38243
UniProt: A9BXG7
Position
complement(6242376..6243188)
Genome map
AA seq 270 aa AA seqDB search
MDKRVFLRGLAAGASVAAMSGAIRAAQAGPLRVGVRGGVDEEIWEVVTRVAREQGLQVKP
VVISGAASPNEALNNGDIEANSFQHVPFLRDQNQQRGYRLVAAGDTYISPIAFYSKKHKR
LADLPAGARLGIPNDPSNQTRALVVLQDQGILKLREGFDPFKGTAGLADIASYQKKVQLV
EAASVVLARSLDDLDASAIVNSFAYQAGLIATRDGIAVERRERNPYVNIIAVHERDRAAP
WVAALLRAYQSEPVRQFIVSRYQGSVLPAF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcgagtatttctgcggggactggcggcgggggcctcggtggcggcgatgtca
ggcgccatccgggccgcgcaggccggcccgctgcgcgtgggcgtgcgcggcggcgtggac
gaggaaatctgggaggtggtgacccgcgtggcacgcgagcaggggctgcaggtcaagccc
gtggtcatcagcggcgcggccagccccaacgaggcgctgaacaacggcgacatcgaggcc
aactccttccagcatgtgccgttcctgcgcgaccagaaccagcagcgcggctaccggctg
gtggcggcgggcgacacctacatctcgcccatcgccttctattcgaaaaagcacaaacgc
ctggccgacctgcccgctggcgcgcgtctgggcattcccaacgatcccagcaaccagacg
cgtgcgctggtggtgctgcaggaccagggcatcctgaagctgcgcgagggcttcgacccc
ttcaagggcacggcgggcctggccgacatcgccagctaccagaagaaggtgcagctggtg
gaggcggcctcggtggtgctggcgcgctcgctggacgatctcgatgcctcggccatcgtc
aacagctttgcctaccaggccgggctgatcgccacgcgcgatggcattgccgtcgaaagg
cgcgagcgcaatccctacgtgaacatcattgccgtgcacgagcgcgaccgcgctgcaccc
tgggtcgcggccctgctgcgcgcctaccagtccgagcccgtgcgccagttcatcgtgagc
aggtaccagggctcggtgctgccggccttctga

DBGET integrated database retrieval system