KEGG   Delftia acidovorans: Daci_5617Help
Entry
Daci_5617         CDS       T00620                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport system periplasmic component
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
dac  Delftia acidovorans
Module
dac_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5617
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Daci_5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 NMT1_2 SBP_bac_3 TAT_signal Drf_DAD Patatin
Motif
Other DBs
NCBI-ProteinID: ABX38246
UniProt: A9BXH0
Position
6246021..6247127
Genome map
AA seq 368 aa AA seqDB search
MTRKTQTEIDRTQDSRCAHGADCGAFGALDAPEASEPSLSRRTLIRAGAAAGALGSAAWF
SGRAGAQPRQKITFAWSQASFCHSPIPVALERGFFERNGLDVELLNWGGSADQLLEALAT
GKADAGAGLIHRWIKPLEAGLDVKLIGSVHGGCLRLVGLKSAGVTLDPSTLKGKTIGVAD
LNSPAKQFYSIHLAKRGLDVDKDIEWRVYPADLLDVAAKKGEIQAIADGDPNLYLIEKRN
PGTFLELGNSAKNEYAESICCVIGAGAKFARANKPAAASVVRALTQASDYIAENPNETAK
IFAKYSPKVPVEDLQRLLAELTFKHHPHGKPLRDEVQAFAADFRTAGVLKKQTDPGRFAS
HITLDVLA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaagacccagaccgagatcgacaggacccaggacagccgctgcgcccatggc
gccgattgcggtgctttcggggcgctcgatgctcccgaggcatccgagccctcgctctcg
cgccgcaccctgatccgcgccggcgccgcagccggcgcgctgggctcggccgcctggttc
agcggccgcgccggggcgcagccgcgccagaagatcacctttgcctggagccaggccagc
ttctgccattcgcccattcccgtggcgctggagcgcggctttttcgagcgcaacggcctg
gatgtggaactgctgaactggggcggctcggccgaccagttgctggaggcgctggccacg
ggcaaggccgatgcgggcgcgggcctgatccaccgctggatcaagccgctggaggcgggg
ctggatgtcaagctcatcggcagcgtgcacggcggctgcctgcgcctggtgggcctgaag
tcggccggcgtcacgctggaccccagcacgctcaagggcaagaccatcggcgtggccgat
ctcaacagtccggccaagcagttctattccatccacctggccaagcgcggcctggatgtg
gacaaggacatcgaatggcgcgtctacccggccgacctgctggatgtggccgccaagaag
ggcgagatccaggccattgccgacggcgacccgaatctctacctgatcgagaaacgcaac
cccggcaccttcctcgaactgggcaacagcgccaagaacgagtacgccgaaagcatttgc
tgcgtgatcggcgcaggcgcaaagttcgcccgggccaacaagcccgcagcggccagcgtg
gtgcgcgcgctgacccaggcctcggactacatcgccgagaaccccaatgagacggcgaag
atctttgccaagtactcgcccaaggtgcccgtcgaagacctgcagcgcctgctggccgag
ctgaccttcaagcaccatccgcacggcaagccgctgcgcgacgaggtccaggcctttgcg
gccgacttccgcacggccggcgtgctcaagaagcagaccgaccctggccgctttgccagc
cacatcacgctggacgtcctcgcatga

DBGET integrated database retrieval system