KEGG   Delftia acidovorans: Daci_5618Help
Entry
Daci_5618         CDS       T00620                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02050  NitT/TauT family transport system permease protein
Organism
dac  Delftia acidovorans
Module
dac_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_5618
Transporters [BR:dac02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Daci_5618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABX38247
UniProt: A9BXH1
Position
6247124..6248179
Genome map
AA seq 351 aa AA seqDB search
MSTARPRWRLGATDAAPGLEREQAQGTRKAGPWRAGLLAAAAWAGLGMLTLLWPNKEIGF
SEWAFTQEFGIAALAVALLLLASAVLPVRPVRAARRIDRWLRPAGAWLVAAPLLLALWET
LTAKLGALPPPFFAPPQSLIDVVHEDWQRLGLSTLYSLRLLLNGIVFGAVIGFLTGVWIG
WSRIAGYWVHPLLRFLGPVPASALLPLAFFFAPSSYSAAVFLVALATFFPVAVLTWSGVA
SVSKSYYDVARTLGASPWFLVLRVAIPAALPQVFVGLFMGLGASFSVLITAEMMGVKAGL
GWYLQWAQGWAAYANMYTALLVMAVLCSGLITLLFTVRDRTLSWQKGTVKW
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcaagaccacgctggcgcctgggcgccacggatgccgcacccggcctggaa
cgggaacaggcgcagggcacgcgcaaggcaggcccctggcgcgccggcctgctggccgcc
gccgcctgggccggcctgggcatgctgaccctgctgtggcccaacaaggagatcggcttc
agcgaatgggcgttcacgcaggagttcggcattgccgccctggccgtggccctgttgctg
ctggcatcggccgtgctgcctgtgcgacccgtacgggcagcacggcgcatcgaccgctgg
ctgcgcccggccggtgcctggctggtggcggcgccgctgctgctggcgctgtgggagacg
ctgacagccaagctcggcgcgctgccgccgcccttctttgcaccaccgcaaagcctgatc
gacgtggtccatgaggactggcagcgcctgggcctgtccacgctgtattcgctgcggctg
ctgctcaacggcatcgtgttcggcgcggtgatcgggtttctcacgggcgtgtggataggc
tggtcgcgcatcgcgggctactgggtgcatccgctgctgcgcttcctggggccggtgccg
gcctcggccctgctgccgctggcctttttcttcgcgccgtccagctactcggcagccgtg
ttcctggtggcgctggccacgttctttccggtggccgtgctgacctggtcgggcgtggca
tcggtcagcaagagctactacgacgtggcgcgcacgctgggcgcatcgccctggttcctg
gtgctgcgcgtggccatcccggccgccctgccccaggtcttcgtgggcctgttcatgggg
ctgggcgcctcgttctcggtgctgatcacggccgagatgatgggcgtgaaggccggcctg
ggctggtacctgcagtgggcccagggctgggcagcctacgccaacatgtacacggcgctg
ctggtcatggccgtgctgtgctcgggcctgatcacgctgctgttcaccgtgcgcgaccgc
acgctgtcgtggcagaagggaaccgtcaaatggtga

DBGET integrated database retrieval system