KEGG   Delftia acidovorans: Daci_5621Help
Entry
Daci_5621         CDS       T00620                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K07302  isoquinoline 1-oxidoreductase subunit alpha [EC:1.3.99.16]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_5621
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.16  isoquinoline 1-oxidoreductase
     Daci_5621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_2 Fer2 Fer2_3 OSK
Motif
Other DBs
NCBI-ProteinID: ABX38250
UniProt: A9BXH4
Position
6250437..6250910
Genome map
AA seq 157 aa AA seqDB search
MTDLTINGKTVSMDLDPETPILWALRDTLEMTGTKFGCGAALCGACTVHMNGQAIRSCVT
PISAAAGQKITTIEAMTSGSDRVGTAVRDAWVRHDVAQCGYCQSGQIMSATAFLKSLPKG
KKPSGEEIDAAMAGNICRCGTYARIRTAVADAARTLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcaccatcaacggcaagaccgtttccatggacctggaccccgagacgccc
attctgtgggccctgcgcgacacgctggagatgaccggcaccaagttcggctgcggcgcg
gcgctgtgcggcgcctgcacggtgcacatgaatggccaggccatacgttcctgcgtgacg
ccgatctcggccgccgcaggccagaagatcaccaccatcgaggccatgacctcgggctcc
gaccgcgtgggcaccgccgtgcgcgatgcctgggtgcgccacgacgtggcccagtgcggc
tactgccagagcgggcagatcatgagcgccacggccttcctcaagtcgctgcccaagggc
aagaagcccagcggcgaggagatagacgcggccatggccggcaacatctgccgctgtgga
acctatgcacgcatccgcacggccgtggccgatgccgcgcgcaccctgggctga

DBGET integrated database retrieval system