KEGG   Delftia acidovorans: Daci_5624Help
Entry
Daci_5624         CDS       T00620                                 

Definition
(GenBank) protein of unknown function DUF6 transmembrane
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Nuc_sug_transp
Motif
Other DBs
NCBI-ProteinID: ABX38253
UniProt: A9BXH7
Position
complement(6254297..6255187)
Genome map
AA seq 296 aa AA seqDB search
MTQKTSPPAMAAALLPWLFVLLWSTGFIGAKFGLPYVEPLTFLTLRYAIVLVLMAAVALV
LRAPWPRSARQWLHIGVSGLFVHGVYLAGVFTAIAHGLPSGVTALVVGLQPLITALVAGT
LLGESVRPRQWAGLALGFTGVALVVAGKIASVPVHALLAMLVPAVVALAGITAGTLYQKR
FCPSFDLRTGSVIQYLPCLVATGALALATETMQVRWSGEFLFALGWLVLVLSVGAVSLLN
LLIRRGGAVHVASLFYLTPPATALIAWAMFGETLGGLALAGMALTAAGVWLARQGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaaacctcgccgcccgccatggcggccgccttgcttccctggctgttcgtg
ctgctgtggagcacgggcttcatcggcgccaagttcggcctgccctatgtggagccgctg
acctttctgacgctgcgctatgccatcgtcctggtgctgatggcggcggtggccctggtg
ctgcgcgcgccctggccgcgttcggcacgccagtggctgcacattggcgtgtcagggctg
ttcgtgcatggcgtgtacctggccggggtgttcacggccatcgcccacggcctgccttcg
ggcgtgacggccctggtggtggggctgcagccgctgatcacggccctggtggccggcacc
ttgctgggcgagtccgtgcggccccggcagtgggccgggctggcgctgggcttcacgggc
gtggccctggtggtggcgggcaagatcgcctcggtgccggtccatgccctgctggccatg
ctggtgccggccgtggtggctctggccggcatcacggccggcacgctgtaccagaagcgg
ttctgtccatcgtttgatctgcgcacgggctcggtcatccagtacctgccctgcctggtg
gcgacgggggcgctggccctggccaccgaaaccatgcaggtgcgctggagcggcgagttc
ctgttcgcgctgggctggctggtgctggtgctgtccgtgggcgcggtcagcctgctcaac
ctgctgatacgccgcggcggcgccgtgcacgtggccagcctgttctacctgacgccaccg
gccacggccctgatcgcctgggccatgttcggcgagacgctgggcggcctggcgctggcg
ggcatggccttgacggcagccggcgtgtggctggcgcggcaggggcgctag

DBGET integrated database retrieval system