KEGG   Delftia acidovorans: Daci_5630Help
Entry
Daci_5630         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX38259
UniProt: A9BXI3
Position
complement(6260644..6261009)
Genome map
AA seq 121 aa AA seqDB search
MASDHALQAGRLWDLWCALALRHVALGGACACGAGGISLRLEDFELDIVDYLQDGGERCE
QPEVAAWFRARPAPGQGAQPLRGLLDALGSDEVPQAVAQWALARLERTLRSFAEVHGGVA
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgaccacgccctgcaggccggccggctctgggacctgtggtgcgccctggcg
ctgcgccatgtcgccctgggcggtgcctgcgcctgcggggcgggcggcatcagcctgcgg
ctggaggacttcgagctggacatcgtggactacctgcaggacgggggcgagcgctgcgag
cagcccgaggtggcggcctggttccgtgcccggcccgcacccgggcagggcgcgcagccg
ctgcgcggcctgctcgatgcgctgggctcggacgaggtgccgcaggccgtggcgcagtgg
gcgctggcgcggctggagcgcacgctgcgttcgttcgccgaggtgcatggtggggtggcg
tcatga

DBGET integrated database retrieval system