KEGG   Delftia acidovorans: Daci_5631Help
Entry
Daci_5631         CDS       T00620                                 

Definition
(GenBank) 5-oxoprolinase (ATP-hydrolyzing)
  KO
K01474  N-methylhydantoinase B [EC:3.5.2.14]
Organism
dac  Delftia acidovorans
Pathway
dac00330  Arginine and proline metabolism
dac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Daci_5631
Enzymes [BR:dac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.14  N-methylhydantoinase (ATP-hydrolysing)
     Daci_5631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydantoinase_B
Motif
Other DBs
NCBI-ProteinID: ABX38260
UniProt: A9BXI4
Position
complement(6261018..6262814)
Genome map
AA seq 598 aa AA seqDB search
MNHPTDSRPVDPVTVEIIRNGLYAVTEEMKTNLTRTAYNLIIYEALDFTVGLFTREGDTV
SIGLGLPMFIRGMSETVKAKIRHFGYENILPGDILVTNDAYTTGSHLNHFTFTMPVFHEG
RLEGFTCCMAHWLDVGGTLGNVTTDIFSEGIQIPIMKYQRQGEVNQDLIDIIAMNVRLAE
RALGDLRAQITAITTGERRYVELLQRYGVDAVNGAIAQIMDSSEAVARKNTLSIPDGVYE
AESFMDDDGLDIGKRIPIRVKVTVQGDEMTVDLSDVSKQVRGFYNSGFTTGIACAQVAYK
CLTTPTDYPVNDGSFRPLKVIMPMGTVISAERPYPMRVWMTFPMTVIDTIFKALAPAIPD
RSIAGHHADLVFPNIHGISPEDGRLFIVGIGPLGGGWGAKSREDGVSVTVCINDGDTHNS
PTEQLEAKYPVLVEKYEIRQDSAGAGQYRGGLGAEMVVQALSPFTVTTRIDRVHCKPWGL
EGGGDAMGNGLAVRHKGEWKTDHANAKIFNVRLERGDAYRMLSGGGGGFGDPLARELDKV
AEDVREGYVSAQVAREVYRVALDGQGQVDHEGTQALRSAPRVPGASGAAAAAVAWDGQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccccactgactccaggcccgtcgatccggtcacggtcgagatcatccgcaac
ggcctgtacgccgtcacggaggagatgaagaccaacctgacgcgcacggcctacaacctc
atcatctacgaggcgctggacttcacggtcggcctgttcacgcgcgagggtgacacggtg
tccatcggcctgggcctgcccatgttcatccgcggcatgtcggagacggtcaaggccaag
atccgccacttcggctacgagaacatcctgccgggtgacatcctggtcaccaacgatgcc
tacaccaccggcagccacctgaaccacttcacgttcaccatgccggtgttccatgagggc
cggctcgaaggcttcacctgctgcatggcccactggctggacgtgggcggcacgctgggc
aacgtcaccacggacatcttcagcgaagggatacagatccccatcatgaagtaccagcgc
cagggcgaggtcaaccaggacctgatcgacatcatcgcgatgaacgtgcgcctggccgag
cgggccctgggcgatctgcgcgcgcagatcacggccatcaccacgggcgagcgccgctat
gtggaactgctgcagcgctatggcgtggatgcggtcaatggcgccatcgcgcagatcatg
gattccagcgaggccgtggcgcgcaagaacacgctgtcgattcccgatggcgtgtacgag
gccgagtccttcatggacgacgacgggctggacatcggcaagcgcattcccatccgcgtc
aaggtcacggtgcagggcgacgagatgacggtggacctgtcggatgtctccaagcaggtg
cgcggcttctacaactcgggcttcaccacgggcatcgcctgtgcgcaggtggcctacaaa
tgcctcaccacgccgaccgactacccggtcaacgacggcagctttcggccgctcaaggtg
atcatgcccatgggcacggtgatcagcgccgagaggccgtatcccatgcgcgtgtggatg
accttccccatgacggtgatcgacaccatcttcaaggccctggcgcccgcgattcccgac
cgctccatcgcgggccaccatgcggacctggtgtttcccaacatccatggcatctcgccc
gaggacgggcggctgttcatcgtcggcatcggcccgctgggcggcggctggggcgccaag
agccgtgaggacggcgtgtccgtcaccgtctgcatcaatgacggcgacacccacaacagc
cccaccgagcagctcgaggccaagtacccggtgctggtggagaagtacgagatccgccag
gactcggccggcgcgggccagtaccggggcggcctgggcgcggagatggtggtgcaggcg
ctgtcgcccttcaccgtcaccacgcgcatcgaccgcgtgcactgcaagccctggggcctg
gagggcggcggcgacgccatgggcaacggcctggccgtgcgccacaagggcgagtggaag
accgaccatgccaacgccaagatcttcaacgtgcgcctggaacgcggcgatgcctaccgc
atgctgtcgggcggcggtgggggctttggcgacccgctggcgcgcgaactggacaaggtg
gccgaggacgtgcgcgaaggctatgtgagcgcccaggtggcccgcgaggtctaccgcgtg
gcgctggatggccagggacaggtggaccacgagggcacgcaggcgctgcgcagtgcgccc
agagtgcccggtgcatccggtgcagcggctgccgccgtggcctgggacgggcagtga

DBGET integrated database retrieval system