KEGG   Delftia acidovorans: Daci_5633Help
Entry
Daci_5633         CDS       T00620                                 

Definition
(GenBank) 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABX38262
UniProt: A9BXI6
Position
complement(6264922..6265782)
Genome map
AA seq 286 aa AA seqDB search
MKLASFIHAGQPRYGQVLAERFLLPPADFLARHPDLLSVLRAQALGELEQALQAGAVSVD
AAQTQALPVIPNPGKLICVGLNYKTHVAETRRADSEHPSLFLRFNDSLAADGDELLRPAF
SERFDWEGELAFVIGRGGRHIAKEDAFDHIAGYACFNDVSVRDWQRHTHQFTPGKNFPGT
APFGPWLVTRDEVADVRSLALQTRLNGSVMQQASLGDLIFDIPTIVAYVSRFTPLSPGDV
IATGTPGGVGDRREPPLYMKHGDVVEVEITGLGVLRNRIGTDSAAV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcgccagcttcatccatgccggacagccccgctacgggcaggttctggccgag
cgcttcctgctgccgcccgccgactttctcgcccgccatcccgacctgctgtccgtgctg
cgcgcacaggcgctgggcgagctggagcaggccctgcaggccggcgccgtgtccgtcgat
gcggcgcagacccaggcgctgcccgtcatccccaaccccggcaagctcatctgcgtgggc
ctgaactacaagacccatgtggccgagacgcggcgcgccgacagcgagcacccgtcgctg
ttcctgcgcttcaacgacagcctggccgccgatggcgacgagctgctgcgcccggccttt
tcggagcgtttcgactgggagggcgagctggccttcgtcatcggccggggcgggcgccac
attgcaaaggaagatgccttcgaccacatcgccggctatgcctgcttcaacgatgtgagc
gtgcgtgactggcagcgccatacgcaccagttcacgcccggcaagaactttcccggcacg
gcgcccttcggcccctggctggtcacgcgcgacgaggtggccgacgtgcgcagcctggcg
ctgcagacccgcctgaacggcagcgtgatgcagcaggccagcctgggcgacctgatcttc
gacatccccaccatcgtggcctatgtgtcgcgcttcacgccgctgtcgcccggcgacgtg
atcgccacgggcacgccgggcggcgtgggcgaccgccgcgagccgcctctgtacatgaag
catggcgatgtggtcgaggtcgagatcacgggcctgggcgtgctgcgcaaccgtatcggc
acggatagcgctgccgtctga

DBGET integrated database retrieval system