KEGG   Delftia acidovorans: Daci_5638Help
Entry
Daci_5638         CDS       T00620                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABX38267
UniProt: A9BXJ1
Position
complement(6269425..6270333)
Genome map
AA seq 302 aa AA seqDB search
MDRFLLMSCFARAVETGSFSAAGRDLGLGQPNVSRYVAALEDHLQARLLHRSTRKLSLTP
EGERYYADIRRILDAVDESESSFRNNVEPSGLLRVACPTALAHAFVLPHVPTFLERYPQL
TLDLQFNDRYVDLVNEGTEIAIRIGHLEDSSLRARRLGWYDRVFVASKDYLAKRGVPQTP
DDLRDHDCIIYTLLSSGAIWRFRDADIPVSGRLRVNSPDAVSAAVTAGLGVAQGPAWLFE
GGLNSGRLQFILTDHAAPPVPVQIVYVANRLLPTRAVVFMDFMGELFSRIPALNGRTPLP
NL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatttctcttgatgagctgcttcgcgcgcgccgtagaaactggaagcttttct
gctgcggggcgtgatctgggcctggggcaacccaatgtcagtcgctatgtggcggcgctg
gaagatcatttgcaggcgcgcctgctccaccggtccacgcgaaagctatctttgacgccg
gagggcgaacgctactacgcggacatccggcgaatcctggatgcggtagatgaatccgaa
tcgtccttcaggaacaacgtcgagccatcaggactcttgcgcgtagcctgcccaacggct
ctcgcacacgcatttgtgttgccacacgtgccgacctttttggagcgctatccccaattg
accttggatcttcaattcaacgatcgatacgtggacttggtcaacgaagggaccgaaatc
gccattcgcatcggacacttggaggacagtagcttgcgggcccggcgtcttggatggtac
gaccgcgtcttcgtggccagcaaggactacctggccaaacgtggagttccgcagactcca
gatgacctgcgcgatcacgattgcatcatctacaccctgttgtcgtccggggcgatctgg
cgattccgtgacgcggacatcccggtttccggcaggctcagggtgaactcgcccgacgca
gtgagtgccgcggtcacggcaggcctgggcgtagcacaaggacctgcgtggctgtttgag
ggtgggctgaacagcggccgattgcagttcattttgacggatcatgcagctccgcccgta
ccggtgcagatcgtctatgtggccaacaggttgctacccacgcgggctgtcgtgttcatg
gactttatgggtgagttgttttcgaggattcctgccttgaatggccgcactcctttgccg
aatctataa

DBGET integrated database retrieval system