KEGG   Delftia acidovorans: Daci_5643Help
Entry
Daci_5643         CDS       T00620                                 

Definition
(GenBank) type III effector Hrp-dependent outer
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBD_N NBD_C baeRF_family10 DUF1970 PRY
Motif
Other DBs
NCBI-ProteinID: ABX38272
UniProt: A9BXJ6
Position
6274444..6275853
Genome map
AA seq 469 aa AA seqDB search
MKLAFYGDDFTGSTDALEVLAFAGLNCALFLDVPDEQTLAEFGPFDAIGVAGASRAMSPT
EMDAQLAPVLAAMSRLPVPLVHYKVCSTFDSSPAIGSIGRVMDLSRTAFGDTAIPIVAAN
PALGRYCAFGNLFARSGTDDRVHRIDRHPIMSVHPVTPMHEADLARHLAGQTAMPVTGFT
LPQLTLDRTEMAGELQRVVDATSGGAVLLDGTTTEHLTETGRLLDGLAGAAQGRQTPLFC
IGGSGLEYALTQWWHETGALPSIPTTHDRFDGVPQVLAVSGSASPLSALQIDAAVDAGFV
ELPVDAAALVAASDPAAELARLVDQALLALRAGHSVMLHSARGPKDPRIEAMLSALAKQG
ISREQARHEGGRLLGHRFGDLVDALLRAHPLKRLLLSGGDTSSHVTQRLAPQALRVVARL
APGAPLCRAISREPHLAQLEIALKGGQMGQPDYFVKALLGTADAHLSLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgccttctacggtgacgatttcaccgggtccaccgatgcactcgaagtgctg
gcgttcgccggcctgaactgcgcactgttcctcgacgtgcccgacgagcagacgctggcc
gagttcggacctttcgacgcgatcggcgtggcgggcgcgagccgcgcgatgtcgccgacc
gagatggacgcgcaactcgcacccgtgcttgcagcgatgtctcgcctgcctgtgccgctg
gtgcactacaaggtctgctcgaccttcgacagctcaccagccatcggcagcatcgggcgg
gtcatggacctgtcgcgcacggccttcggtgacaccgcgattcccatcgttgccgccaac
cccgcgctcggccgctactgcgccttcggcaatctgttcgcgcgctccggcaccgacgac
cgtgtgcatcgcatcgatcgccacccaatcatgagcgtgcaccctgtgacgccgatgcac
gaggcggatctggcgcgccacctcgcagggcagaccgcgatgcctgtcaccggcttcacg
ctgccgcaactcacactcgaccgcaccgagatggcgggcgagttgcagcgcgtggttgac
gccacgtcgggcggcgcggtgctgctggacggcaccacgactgagcacttgaccgagacc
ggccggctgctcgatgggctcgctggtgcggctcagggccgccagacacccttgttctgc
atcggcggctcgggcctcgaatatgcgctgacgcagtggtggcacgagaccggcgccctg
ccatccatcccgactacgcacgaccgcttcgacggcgtgccgcaggtgctggccgtctca
ggcagcgcttcgccgctgagcgcgctgcagatcgacgcagccgttgatgcgggcttcgtc
gagttgccggtggacgctgccgcgttggtcgcagcgagcgatcccgcagcggaactcgcc
cgcctcgtcgatcaggccctgctagcgctgcgcgccggccacagcgtgatgctgcacagc
gcgcgcggcccgaaggacccgcgtatcgaagcgatgctgtccgcgctcgccaagcaaggc
atcagccgggagcaggcccgccacgaaggcggccgcctgctgggacaccgcttcggcgac
ctcgtcgatgcgctgctgcgtgcacatcccctcaagcgcctgctgctgtcgggcggcgat
acctccagccacgtcacgcagcgactagccccgcaggctctgcgcgtcgtcgcccggttg
gcgccaggcgctccgctgtgccgcgccatctcgcgcgagccgcacctggcacagctcgaa
attgcgctcaagggcggccagatgggccagcccgactatttcgtcaaggcgttgctcggc
acggccgacgcccacctctcacttgcataa

DBGET integrated database retrieval system