KEGG   Delftia acidovorans: Daci_5644Help
Entry
Daci_5644         CDS       T00620                                 

Definition
(GenBank) TRAP dicarboxylate transporter, DctP subunit
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctP DUF3581
Motif
Other DBs
NCBI-ProteinID: ABX38273
UniProt: A9BXJ7
Position
6275872..6276891
Genome map
AA seq 339 aa AA seqDB search
MNSIDRRRAIVTGAALISAPALVLPRFARAAEFTYKFGTNLPATHPLNVRAMQAAERILK
DTGGQVQINVFPNNQLGNDADMLSQLRAGGLEFFTVSGVNVLSQLVPVSSMWGLGFAWAN
DEAVNKALDGDLGKFLRAQFPKVGLMAMDTVWSSGFRQITNSVRPINTPDDLKGLKIRVP
VSPLWTSLFKHLGAAPTSINFAETYSSLQTKVVDGQENPLAIISIAKLYEVQKYCSMTNH
MWDGYWCMTNQKVWSRMPEKVRPIIAKHLNQAALDMRADGAKLDASLRPELTSRGLAFND
PEIGPFRARLLASGFYAEWKKKYGDEAWALLEKHTGKLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgatcgaccgccgacgtgccatcgtgactggcgccgcactgatcagcgcaccg
gcattggtgctgccgcgcttcgcgcgcgccgccgaatttacctacaagttcgggaccaac
ctgccggcgacacatcccctcaacgtgcgagcgatgcaggccgctgagcgcatcctgaaa
gacacgggtggccaggttcagatcaacgtcttcccgaacaaccaacttggcaacgacgcc
gacatgctctcgcagctgcgcgcaggcgggctcgagttcttcaccgtctcgggcgtgaac
gtgctgtcgcagctcgtgcccgtctcatcgatgtgggggcttggattcgcctgggcgaac
gacgaggccgtcaacaaggcgctggacggtgatctcggcaaatttctgcgcgcgcagttc
cccaaggtcggcctgatggcgatggacaccgtgtggagttccggcttccggcagatcacc
aacagcgtccgtccgatcaacacgcccgacgacctcaagggcttgaagattcgcgtgccg
gttagccctctgtggacctcgctgttcaagcatctcggcgccgcacccacttctatcaac
ttcgcggagacatattcgtctctgcagacgaaggtggtcgatggtcaggaaaaccctttg
gcgatcatctcgatcgccaaactctacgaggtgcaaaagtactgttccatgaccaaccac
atgtgggatggctattggtgcatgacgaaccaaaaggtctggagccgcatgcccgagaag
gtaaggcccatcattgccaagcacctgaaccaggctgcgctcgacatgcgcgccgatggc
gcgaagctcgacgcctcgttgcggcccgagctgacttccagggggctggccttcaacgac
ccggaaatcgggccgttccgtgcgcggcttcttgcgtcgggcttctacgccgagtggaag
aagaagtatggcgatgaggcctgggccttgctcgagaagcacaccggcaagctgggctga

DBGET integrated database retrieval system