KEGG   Delftia acidovorans: Daci_5646Help
Entry
Daci_5646         CDS       T00620                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ABX38275
UniProt: A9BXJ9
Position
6278798..6279568
Genome map
AA seq 256 aa AA seqDB search
MTTISESRVALVTGGAKGIGAEVCARLAVLGHHVLVADLDVDAATATALELSAAGGRATA
LRLDVGKPEAIATAFEQVEREHGRCDILVNSAGIAKVFPFIDFPLDNFVATMNVNVTGTL
LCAQAAARLMVKQGWGRIVNIASVAGMRAVGSGRTAYGTSKGAVIALTRQMAVELAEHGI
TANAVAPGPVDTPMTQALHTAQFRAEYSKAIPMNRYGTCGEIASAVTYLVSEDARYVTGI
AMPVDGGFLASGARGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatttccgaatcacgtgtcgcgctcgtcaccggcggcgccaagggcatcggc
gcagaggtgtgcgcccgtctggcggtcctcggccaccatgtcctcgtggccgacctcgat
gtcgatgcggcgacggcgacggcactcgagctcagtgctgccggcggccgggccaccgcg
ctgcggctggacgtcggcaagcccgaggctattgccacggcgttcgagcaggtcgagcgc
gagcacgggcgctgcgacatacttgtcaactctgccggcattgcgaaggtcttccccttc
atcgacttcccgctcgacaacttcgtcgcgacgatgaacgtcaacgtcaccggcacgctg
ctgtgcgcgcaagcggcggctcggctgatggtgaagcagggctggggccgcatcgtcaac
atcgcgtctgtcgccggcatgcgcgcagtggggagcggccgcaccgcctacggcacgtcc
aaaggggcggtgattgcgctgacgcggcagatggccgtggaactggccgagcacgggatt
accgccaacgcggtggctccaggccccgtcgatacgccgatgacgcaggcgctgcacacc
gcgcagttccgcgccgaatattcgaaggccattccgatgaatcgctacggcacctgtggg
gagatcgcctcggccgtgacctacttggtatccgaagacgctcggtacgtaaccggcatc
gcgatgcccgtcgatggcggctttctcgcgtcaggcgcacgcggcatataa

DBGET integrated database retrieval system