KEGG   Delftia acidovorans: Daci_5653Help
Entry
Daci_5653         CDS       T00620                                 

Definition
(GenBank) acriflavin resistance protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran
Motif
Other DBs
NCBI-ProteinID: ABX38281
UniProt: A9BXK5
Position
complement(6286343..6289411)
Genome map
AA seq 1022 aa AA seqDB search
MSEGRFNLSALAVRERSITLFLILLISLTGVFAFLKLGRAEDPAFTVKVMTIITAWPGAT
PQEMQDQVAEKLEKRLQELRWYDRTETFVRPGLAFTTLTLLDSTPPGEVQEEFYQARKKL
GDEARNLPAGVIGPMVNDEYADVTFAIYALKARGEEPRALVRDAEALRQRLLHVPGVKKV
NIVGEQSERIYVEFSHERLATLGISPQDVFAALNNQNALTPAGSVETQGPQVFIRIDGAF
DALQKIRDTPIVAQGRTVRLSDIATVQRGYEDPSTFIIRNGAEPALLLGVVMRDGWNGLD
LGKALDREVGAINADMPLGMGLSKVTDQAVNISASVDEFMLKFLAALLVVLVVCFASMGW
RVGVVVAAAVPLTLAAVFIIMAATGKNFDRITLGSLILALGLLVDDAIIAIEMMVVKMEE
GYDRVAASAYAWSHTAAPMLSGTLVTAVGFMPNGFARSAAGEYTSNMFWIVGIALIASWV
VAVVFTPYLGVKMLPPLKKVEGGHAAMYGTPRYERLRRVLGKVIARKGMVAAVVGGLMVA
SVLGMSIVKKQFFPISDRPEVMVEVQMPYGTSIGQTSETTRKVEAWLLQQPESEIVTAYI
GQGAPRFFLAISPELPDPSFAKIVVRTANQAQRDALKLRLREAIAQGLAPQAQVRASQIV
FGPYSPFPVAYRVSGPDPQRLRDIAGQVHQVLHDSPMMRTVNSDWGVRTPVMRFTLDQDR
LQAMGLTSAAVAQQLQFLLSGVPVTTVREDIRTVQVMARSAGGTRHDVARVGDFTLTNAT
GQRIPLSQLGEVTVQMEEPVMRRRDRMPTITVRGDIDDSLQPPDVSAAITRQLEPIRKAL
PAGYRIDEAGSIEESGKAMTAMLPLFPIMIAITLIIIILQVRSISAMVMVFLTSPLGLIG
VVPTLIVFQQPFGINALVGLIALSGILMRNTLILIGQIQHNEQEGLAPFQAVVEATVQRA
RPVILTALAAILAFIPLTQSVFWGTLAYTLIGGTLAGTVLTLVFLPAMYSIWFRIRPGEA
RR
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaggccgtttcaacctgtcggcgcttgccgtccgtgagcgctccatcacgctg
ttcctgatcctgctgatttcgctgacgggtgtctttgccttcctgaagctgggccgggcg
gaagatccggccttcaccgtcaaggtcatgaccatcatcacggcctggcctggcgccacc
ccgcaggaaatgcaggaccaggtggcagagaagctggaaaagcgcctgcaggagctgcgc
tggtatgaccgcaccgaaaccttcgtcaggccggggctggccttcaccacgctgaccctg
ctcgactccacgcccccaggcgaggtgcaggaggagttctaccaggcccgcaagaagctc
ggtgacgaggcccgcaacctgccggcgggcgtgatcggcccgatggtgaacgacgagtac
gccgacgtgacctttgcgatctacgccctcaaggcgcgcggcgaagagccccgggcgctg
gtgcgcgatgccgaagccttgcgccagcgtcttttgcatgtgccgggcgtcaagaaggtc
aacatcgtcggcgagcaatccgagcggatctacgtggagttctcgcacgagcgcctggcc
acgctgggcatcagtccgcaggacgtcttcgcggcattgaacaaccagaacgcactcacg
cctgccgggtcggtggagacccagggaccgcaggtgttcatccgcatcgacggggcgttc
gacgcgctgcagaagatccgcgacacgcccatcgtggcccagggccgcacggtcaggctg
tccgacatcgccaccgtccagcgcggctacgaagatccctcgaccttcatcatccgcaac
ggcgcggagccggccttgctgctgggcgtcgtcatgcgcgacggctggaacgggctggac
ctgggcaaggcgctggaccgggaggtgggcgccatcaacgcagacatgccgctgggcatg
ggcctgagcaaggtgacggaccaggccgtgaacatcagcgcctccgtcgatgagttcatg
ctcaagttcctggccgcgctgctggtcgtgctggtggtgtgcttcgccagcatgggctgg
cgcgttggcgtggtggtggctgcggccgtgccgctgacgctggcggccgtgttcatcatc
atggccgccacgggaaagaatttcgaccgcatcacgctcggctcgctgatccttgcgctg
ggcctgctggtggacgacgccatcatcgccatcgagatgatggtggtgaagatggaagag
ggctacgaccgcgtggccgcgtccgcctacgcctggagccataccgcggcacccatgctg
tccggaacgctggtgacggcggtgggcttcatgcccaacgggttcgcccgctccgctgca
ggcgagtacaccagcaacatgttctggatcgtcggcatcgcgctcatcgcgtcctgggtg
gtggccgtggtgttcacgccctatctgggcgtgaagatgctgccccctctcaagaaggtc
gaaggcggacatgcggcgatgtatggcacgccccgctacgagcgcctgcggcgcgtgctg
ggcaaggtgatcgcccgcaagggcatggtggcggcagtcgtgggcgggctcatggtggct
tccgtgctgggcatgtccatcgtgaagaagcagttcttccccatctccgaccggcccgag
gtgatggtcgaggtgcagatgccctacggcacctccattggccagacgagcgagaccacc
cgcaaggtggaagcctggctgctgcagcagcccgaatcggagatcgtgaccgcctatatc
ggccagggcgcaccgcgcttttttctggccatctcgcctgagctgcccgacccgtcgttc
gccaagatcgtcgtgcgcaccgccaaccaggcgcagcgcgacgcgctcaagctcaggctg
cgcgaggccatcgcccagggactggctccgcaggcgcaggtgcgcgcatcgcagatcgtg
ttcgggccgtactccccgttccccgtggcgtatcgcgtctccggccccgacccgcagcgg
ctgcgcgacattgccggccaggtgcaccaggtgctgcacgacagcccgatgatgcggacc
gtgaactccgactggggcgtgcgcacccccgtcatgcgcttcaccctggaccaggaccgg
ctgcaggccatgggcctgacctccgcggcggtcgcgcagcagttgcagttcctgctcagc
ggcgtgcccgtgaccaccgtgcgcgaggacatccgcaccgtgcaggtgatggcgcgttct
gcgggcggcacccgccacgatgtggccagggtcggcgacttcacgctcaccaacgccact
ggccagcgcataccgctgtcgcagctgggagaggtcaccgtgcagatggaggagcccgtc
atgcgccgccgcgaccgcatgcccaccatcacggtccgcggagacatcgatgacagcctg
cagccgcccgatgtctcggcggccatcacccggcagctggagcccatcaggaaggcgttg
cctgcgggctaccgcatcgacgaggccggctccatcgaggaatccggcaaggccatgacg
gccatgctgcccctgttcccgatcatgatcgccatcacgctgatcatcatcatcttgcag
gtgcggtcgatatcggccatggtcatggtgttcctgaccagccccctgggattgatcggc
gtggtgccgacgctcatcgtctttcagcagcccttcggcatcaatgcactggtggggctg
atcgcgctgtcgggcatcctgatgcgcaacacgctgatcctgatcgggcagatccagcac
aacgagcaggaggggcttgcgccgttccaggcggtggtggaggccactgtccagcgcgcc
cggcccgtgatcctgaccgcgctggcggcgatcctggccttcatcccgctgacccaatcg
gtgttctggggaacgctggcctatacgctgatcggcggcacgctcgccggcacggtgctg
acgctggtcttcctgcccgccatgtactcgatctggttcaggatcaggcccggcgaagca
cggcgctga

DBGET integrated database retrieval system