KEGG   Delftia acidovorans: Daci_5656Help
Entry
Daci_5656         CDS       T00620                                 

Definition
(GenBank) RND efflux system, outer membrane lipoprotein, NodT family
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP
Motif
Other DBs
NCBI-ProteinID: ABX38284
UniProt: A9BXK8
Position
6291375..6292880
Genome map
AA seq 501 aa AA seqDB search
MPRLAAPVFLMLASLCAGCAVGPDYQPPAPALPQAYMGSRVLGETKPPSPASSTDLAAWW
AAFGDPQMARLVTAALQQNLDVAQAAGRVLQARAGLDAAAAALLPSAQISAQTARSYQSV
ETPLGRVLDSMPGFDRYGSAQEANLGASWELDLFGGLRRARQASLAEYQASEAGATAVRL
AVAAQTADTYIQIRGLQARLAVARSQVQAQQQLRSIVELRFGKGLSPELQLRQVEGALAR
AQATVPPLENALEAALNAMDVMLATAPGTHRAELADPRPVPVLPTLSLAEAPGDLLRRRP
DLIAAERRLAASNARIGVAIAEYYPKLSISGLIGSATSISAGNLFSAGASQASVVGGLRW
RLFDFGRINAQIHQAQAQEAESLAAYRQSVLRATEEVENALVSLDKRQELMTVLARGADA
LTRARQAAGAAYDKGVVSLIEVLQADESLLGVLDAQALARTESARSTVAIFKALGGGWTP
EPLPSRALAAASHGLPASVAP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcttgccgcccccgtctttctgatgctcgccagcctctgtgcagggtgtgcg
gtaggccctgactaccagccgcccgccccggccctgccccaggcctacatgggcagccgc
gttctgggtgagaccaagccgccctcgccggcctcctccacggaccttgcagcctggtgg
gcagcctttggcgatccgcagatggcgcgcctcgtcacggcggcactgcagcaaaacctg
gatgttgcccaggccgctggccgcgtgcttcaggcacgcgccgggctggatgcggcggca
gccgccctgctgccgtcggcccagatctcggcgcaaacggccaggagctatcagtcggtc
gagactccgctaggccgggtgctcgactccatgccggggttcgatcgctacggcagcgcc
caggaggccaacctcggagccagttgggagcttgatctcttcggcggcctgcgcagggcc
cggcaggcctccctggccgagtaccaggcatcggaagccggcgccactgccgtgcggctc
gcggtggccgcacagactgcggacacctatatccagattcgcggcctgcaggcgcggctg
gcagtggcacgctcgcaagtgcaagcccagcagcaactgcgctccatcgtcgaactgcgg
tttggcaaaggactgtcacccgagcttcagctgcgccaggtcgagggagcgctcgcacgg
gcacaagccaccgtcccgccgctggaaaatgcgctcgaggccgccctcaacgccatggac
gtgatgctggccacggcacccggcacgcaccgggccgaactggccgatccccgccccgtc
cccgtattgccaaccctttccctggcggaggcgcccggcgatctgctgcggcgacgcccg
gacctcatcgcggcggagcgacgcctggcagcgtcgaacgcacgcatcggcgtggcgatc
gccgagtactacccgaagctgtcgatcagcggcctgatcggcagcgccacctccatctcc
gcaggcaatctcttcagcgccggcgcgtcgcaggcaagcgttgtgggcggcctgcgctgg
cggctgttcgacttcggtcgcatcaacgcccagatccaccaggcgcaggcacaggaggcg
gaaagccttgccgcctaccggcagtcggtactgcgcgccacggaagaagtggagaacgcc
ctggtctcgctggacaagcggcaggagctgatgaccgtgctcgccaggggcgcggatgcg
ctcacgcgggcccggcaggccgcaggcgccgcctacgacaagggcgtggtcagcctgatc
gaggtactgcaggcggatgaaagcctgctgggcgtgctcgatgcacaggcgctggcacgg
acggagtcggcgcgatcgacggtcgcgatcttcaaggcacttggcggcggctggacgccg
gagcccctgccttccagggcgttggcggccgccagccacggtcttcccgccagcgttgcc
ccctga

DBGET integrated database retrieval system