KEGG   Delftia acidovorans: Daci_5657Help
Entry
Daci_5657         CDS       T00620                                 

Definition
(GenBank) hypothetical protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4148 SurE Nucleolin_bd
Motif
Other DBs
NCBI-ProteinID: ABX38285
UniProt: A9BXK9
Position
6293020..6293346
Genome map
AA seq 108 aa AA seqDB search
MSNTTPSPTVAAAARILKPALAAIAFSTCFAAHSQPQNASAATSDAALSRAEVIADLALW
RRAGLDRHAEISISYGVETPEYRAAYQEYLRLRNSEAFQAEVRKALSR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaaccccctcccccaccgttgctgcagccgcacgcatcctgaagccggcg
cttgcggccatcgccttctcgacctgcttcgcagcccattcgcagccgcaaaacgcctcg
gcagccacatcggacgcagcgctttcccgcgccgaagtcatcgccgatctcgcactctgg
cgccgcgccggattggaccgccatgcggagatatcgatctcctacggagtcgaaacgccg
gaatatcgggccgcataccaggagtacctgcgccttcgcaacagcgaggcgttccaggcg
gaggtccgcaaggcgctgagtcggtaa

DBGET integrated database retrieval system